SitesBLAST
Comparing WP_086510087.1 NCBI__GCF_002151265.1:WP_086510087.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3kboA 2.14 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium in complex with NADP
40% identity, 100% coverage: 1:311/311 of query aligns to 1:312/312 of 3kboA
- active site: M95 (= M91), R227 (= R223), E256 (= E256), H275 (= H275)
- binding N-(2-hydroxyethyl)-N,N-dimethyl-3-sulfopropan-1-aminium: N36 (≠ D30), A53 (= A53), R55 (≠ Q55), R56 (= R57)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (≠ K85), M99 (≠ I95), G143 (= G139), A144 (≠ L140), G145 (= G141), V146 (≠ A142), L147 (≠ I143), W165 (= W161), S166 (= S162), R167 (= R163), S168 (= S164), K170 (= K166), L197 (= L193), P199 (= P195), L225 (≠ P221), A226 (≠ G222), R227 (= R223), D251 (= D251), H275 (= H275), A278 (≠ G278), Y312 (= Y311)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
41% identity, 98% coverage: 7:311/311 of query aligns to 11:315/315 of 5vg6B
- active site: M98 (= M91), R230 (= R223), D254 (= D251), E259 (= E256), H278 (= H275)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A74 (= A66), R92 (≠ K85), M102 (≠ I95), L147 (= L140), G148 (= G141), D149 (≠ A142), L150 (≠ I143), W168 (= W161), S169 (= S162), R170 (= R163), T171 (≠ S164), K173 (= K166), L201 (= L194), P202 (= P195), T207 (= T200), V228 (≠ P221), R230 (= R223), H278 (= H275), A280 (= A277), S281 (≠ G278), Y315 (= Y311)
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
41% identity, 97% coverage: 9:311/311 of query aligns to 11:312/312 of 7jqiA
- binding 2-oxoglutaric acid: G64 (= G65), A65 (= A66), G66 (= G67), R227 (= R223), H275 (= H275)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A66), R89 (≠ K85), M99 (≠ I95), A144 (≠ L140), G145 (= G141), V146 (≠ A142), L147 (≠ I143), W165 (= W161), S166 (= S162), R167 (= R163), T168 (≠ S164), K170 (= K166), L198 (= L194), P199 (= P195), L225 (≠ P221), R227 (= R223), H275 (= H275), A278 (≠ G278), Y312 (= Y311)
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
41% identity, 97% coverage: 9:311/311 of query aligns to 11:312/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A66), R89 (≠ K85), M99 (≠ I95), A144 (≠ L140), G145 (= G141), V146 (≠ A142), L147 (≠ I143), W165 (= W161), S166 (= S162), R167 (= R163), T168 (≠ S164), K170 (= K166), L198 (= L194), P199 (= P195), L225 (≠ P221), R227 (= R223), H275 (= H275), A277 (= A277), A278 (≠ G278), Y312 (= Y311)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: D11 (= D9), W15 (= W13), A65 (= A66), R227 (= R223), H275 (= H275), T280 (= T280)
Sites not aligning to the query:
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
41% identity, 97% coverage: 9:311/311 of query aligns to 12:313/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A66 (= A66), R90 (≠ K85), M100 (≠ I95), A145 (≠ L140), G146 (= G141), V147 (≠ A142), L148 (≠ I143), W166 (= W161), S167 (= S162), R168 (= R163), T169 (≠ S164), K171 (= K166), L199 (= L194), P200 (= P195), L226 (≠ P221), A227 (≠ G222), R228 (= R223), D252 (= D251), H276 (= H275), A279 (≠ G278), Y313 (= Y311)
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
40% identity, 96% coverage: 13:311/311 of query aligns to 21:316/316 of 4zqbB
- active site: L99 (≠ M91), R231 (= R223), E260 (= E256), H279 (= H275)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (≠ K85), M103 (≠ I95), G147 (= G139), L148 (= L140), G149 (= G141), E150 (≠ A142), L151 (≠ I143), W169 (= W161), S170 (= S162), R171 (= R163), S172 (= S164), K174 (= K166), L202 (= L194), P203 (= P195), F229 (≠ P221), R231 (= R223), H279 (= H275), S281 (≠ A277), A282 (≠ G278), Y316 (= Y311)
4z0pA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
37% identity, 95% coverage: 16:311/311 of query aligns to 18:316/316 of 4z0pA
- active site: L95 (≠ M91), R231 (= R223), G250 (≠ R246), D255 (= D251), E260 (= E256), H279 (= H275)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (≠ K85), M99 (≠ I95), M144 (≠ L140), G145 (= G141), V146 (≠ A142), L147 (≠ I143), W165 (= W161), S166 (= S162), R167 (= R163), S168 (= S164), R170 (≠ K166), L197 (= L194), P198 (= P195), A229 (≠ P221), G230 (= G222), R231 (= R223), H279 (= H275), A281 (= A277), A282 (≠ G278), Y316 (= Y311)
- binding oxalic acid: W50 (= W45), G70 (= G65), A71 (= A66), G72 (= G67), H114 (≠ F110), R115 (≠ D111), R231 (= R223), H279 (= H275)
4weqA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADP and sulfate (see paper)
37% identity, 95% coverage: 16:311/311 of query aligns to 18:316/316 of 4weqA
- active site: L95 (≠ M91), R231 (= R223), G250 (≠ R246), D255 (= D251), E260 (= E256), H279 (= H275)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R89 (≠ K85), M99 (≠ I95), M144 (≠ L140), G145 (= G141), V146 (≠ A142), L147 (≠ I143), W165 (= W161), S166 (= S162), R167 (= R163), S168 (= S164), R170 (≠ K166), L197 (= L194), P198 (= P195), A229 (≠ P221), G230 (= G222), R231 (= R223), D255 (= D251), H279 (= H275), A281 (= A277), Y316 (= Y311)
5bqfA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADP, hepes and l(+)-tartaric acid
33% identity, 90% coverage: 31:311/311 of query aligns to 34:317/317 of 5bqfA
- active site: E261 (= E256), H280 (= H275)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A72 (= A66), R90 (≠ K85), M100 (≠ I95), G144 (= G139), L145 (= L140), G146 (= G141), I147 (≠ A142), L148 (≠ I143), W166 (= W161), S167 (= S162), R168 (= R163), T169 (≠ S164), L198 (= L194), P199 (= P195), A230 (≠ P221), G231 (= G222), R232 (= R223), H280 (= H275), A283 (≠ G278), Y317 (= Y311)
4xcvA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH
33% identity, 90% coverage: 31:311/311 of query aligns to 34:317/317 of 4xcvA
- active site: E261 (= E256), H280 (= H275)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A72 (= A66), R90 (≠ K85), M100 (≠ I95), G144 (= G139), L145 (= L140), G146 (= G141), I147 (≠ A142), L148 (≠ I143), W166 (= W161), S167 (= S162), R168 (= R163), T169 (≠ S164), K171 (= K166), L198 (= L194), P199 (= P195), A230 (≠ P221), G231 (= G222), R232 (= R223), H280 (= H275), A283 (≠ G278), Y317 (= Y311)
5tsdA Crystal structure of NADPH-dependent 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH and oxalate
33% identity, 90% coverage: 31:311/311 of query aligns to 33:316/316 of 5tsdA
- active site: E260 (= E256), H279 (= H275)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A71 (= A66), R89 (≠ K85), M99 (≠ I95), G143 (= G139), L144 (= L140), G145 (= G141), I146 (≠ A142), L147 (≠ I143), W165 (= W161), S166 (= S162), R167 (= R163), T168 (≠ S164), K170 (= K166), L197 (= L194), P198 (= P195), A229 (≠ P221), G230 (= G222), R231 (= R223), D255 (= D251), H279 (= H275), Y316 (= Y311)
- binding oxalic acid: W50 (= W45), G70 (= G65), A71 (= A66), G72 (= G67), R231 (= R223), H279 (= H275)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
33% identity, 68% coverage: 95:304/311 of query aligns to 93:303/306 of 5mh6A
- binding 2-Ketohexanoic acid: R224 (= R223), H272 (= H275), Y280 (vs. gap)
- binding magnesium ion: T130 (= T128), A132 (≠ K130), F210 (≠ L209), E211 (≠ A210), M213 (≠ L212), G225 (= G224), P226 (≠ S225), V228 (≠ I227), E230 (= E229), D241 (≠ E240), S251 (≠ P254)
- binding nicotinamide-adenine-dinucleotide: G142 (= G141), T143 (≠ A142), L144 (≠ I143), R164 (= R163), P196 (= P195), T201 (= T200), V222 (≠ P221), A223 (≠ G222), R224 (= R223), H272 (= H275), S274 (≠ A277)
Sites not aligning to the query:
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
33% identity, 68% coverage: 95:304/311 of query aligns to 95:305/308 of 5mhaB
- binding 2-Ketohexanoic acid: R226 (= R223), H274 (= H275), Y282 (vs. gap)
- binding (2R)-2-hydroxyhexanoic acid: Y282 (vs. gap)
- binding magnesium ion: F212 (≠ L209), E213 (≠ A210), M215 (≠ L212), D243 (≠ E240)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L143 (= L140), G144 (= G141), T145 (≠ A142), L146 (≠ I143), R165 (≠ S162), R166 (= R163), S167 (= S164), P180 (≠ D177), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ P221), A225 (≠ G222), R226 (= R223), H274 (= H275), S276 (≠ A277)
Sites not aligning to the query:
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
33% identity, 68% coverage: 95:304/311 of query aligns to 95:305/308 of 5mhaA
- binding 2-Ketohexanoic acid: R226 (= R223), H274 (= H275), Y282 (vs. gap)
- binding magnesium ion: T132 (= T128), A134 (≠ K130)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L143 (= L140), G144 (= G141), T145 (≠ A142), L146 (≠ I143), R165 (≠ S162), R166 (= R163), S167 (= S164), P180 (≠ D177), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ P221), A225 (≠ G222), R226 (= R223), H274 (= H275), S276 (≠ A277)
Sites not aligning to the query:
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
33% identity, 68% coverage: 95:304/311 of query aligns to 95:305/308 of 5mh5A
- binding 2-Ketohexanoic acid: R226 (= R223), H274 (= H275), Y282 (vs. gap)
- binding magnesium ion: T132 (= T128), A134 (≠ K130), F212 (≠ L209), E213 (≠ A210), M215 (≠ L212), D243 (≠ E240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G142 (= G139), L143 (= L140), G144 (= G141), T145 (≠ A142), L146 (≠ I143), R165 (≠ S162), R166 (= R163), S167 (= S164), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ P221), A225 (≠ G222), R226 (= R223), H274 (= H275), S276 (≠ A277)
Sites not aligning to the query:
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
37% identity, 56% coverage: 131:305/311 of query aligns to 141:310/319 of 5v6qB
- active site: R230 (= R223), D254 (= D251), E259 (= E256), H277 (= H275)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F148 (≠ L138), L150 (= L140), G151 (= G141), R152 (≠ A142), I153 (= I143), T172 (≠ S162), R173 (= R163), V201 (≠ L194), P202 (= P195), S206 (= S199), T207 (= T200), V228 (≠ P221), G229 (= G222), R230 (= R223), H277 (= H275), A279 (= A277)
Sites not aligning to the query:
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
37% identity, 56% coverage: 131:305/311 of query aligns to 140:309/319 of 5v7nA
- active site: R229 (= R223), D253 (= D251), E258 (= E256), H276 (= H275)
- binding 2-keto-D-gluconic acid: R229 (= R223), H276 (= H275), S279 (≠ G278), R285 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L149 (= L140), G150 (= G141), R151 (≠ A142), I152 (= I143), T171 (≠ S162), R172 (= R163), V200 (≠ L194), P201 (= P195), S205 (= S199), T206 (= T200), V227 (≠ P221), G228 (= G222), R229 (= R223), H276 (= H275), A278 (= A277)
Sites not aligning to the query:
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
37% identity, 56% coverage: 131:305/311 of query aligns to 139:308/317 of 5v7gA
- active site: R228 (= R223), D252 (= D251), E257 (= E256), H275 (= H275)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F146 (≠ L138), L148 (= L140), G149 (= G141), R150 (≠ A142), I151 (= I143), T170 (≠ S162), R171 (= R163), V199 (≠ L194), P200 (= P195), S204 (= S199), T205 (= T200), V226 (≠ P221), G227 (= G222), R228 (= R223), H275 (= H275), A277 (= A277)
- binding oxalate ion: R228 (= R223), H275 (= H275)
Sites not aligning to the query:
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
37% identity, 56% coverage: 131:305/311 of query aligns to 139:308/318 of 5j23A
- active site: R228 (= R223), D252 (= D251), E257 (= E256), H275 (= H275)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: L148 (= L140), G149 (= G141), R150 (≠ A142), I151 (= I143), T170 (≠ S162), R171 (= R163), P200 (= P195), S204 (= S199), T205 (= T200), R228 (= R223)
Sites not aligning to the query:
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
37% identity, 57% coverage: 103:280/311 of query aligns to 113:282/311 of 3bazA
- active site: R230 (= R223), A251 (= A248), D254 (= D251), E259 (= E256), H277 (= H275)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (= G139), L150 (= L140), G151 (= G141), R152 (≠ A142), I153 (= I143), S172 (= S162), R173 (= R163), S174 (= S164), C201 (≠ L194), P202 (= P195), T207 (= T200), I228 (≠ P221), G229 (= G222), R230 (= R223), D254 (= D251), H277 (= H275), G279 (≠ A277)
Sites not aligning to the query:
Query Sequence
>WP_086510087.1 NCBI__GCF_002151265.1:WP_086510087.1
MRILLHIDDIEAWRDALAERLPGAEIVTADDPADKRRDADYLAVWKPPEALLAEQTRARG
IVNLGAGVDALLSNPALPAGVPIVKLRDAGMAELIGDYVRYGVLHFQRDFDRYRRQQASR
EWHEHNVTAKRDWPVGVLGLGAIGARVAAMIAADGFPVHGWSRSPKSLEGITCHHGDEGL
VELLGQVRTLVLLLPGTNSTRHIINAAALAALPEGASLINPGRGSLIDEAALLAALGEGE
QEGRLRGAILDAFPEEPLPESSPLWRHPRIWVTPHMAGPTPLDEAVDQVAEAIRAFEAGD
EVESVDPEAGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory