SitesBLAST
Comparing WP_086510096.1 NCBI__GCF_002151265.1:WP_086510096.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wy2A Crystal structure of alpha-glucosidase in complex with glucose (see paper)
75% identity, 99% coverage: 4:535/536 of query aligns to 1:533/535 of 3wy2A
- active site: D97 (= D100), R197 (= R200), D199 (= D202), E268 (= E271), H329 (= H332), D330 (= D333)
- binding beta-D-glucopyranose: D59 (= D62), Y62 (= Y65), H102 (= H105), R197 (= R200), D199 (= D202), E268 (= E271), H329 (= H332), D330 (= D333), R397 (= R400)
- binding glycerol: S101 (= S104), D169 (= D172), V170 (≠ L173), P175 (= P178), R178 (= R181), Q179 (≠ A182), F203 (= F206), Y204 (= Y207), H206 (= H209), D240 (= D243), P244 (= P247), E280 (= E283)
- binding magnesium ion: D20 (= D23), R22 (≠ N25), V26 (= V29), D28 (= D31)
3wy1A Crystal structure of alpha-glucosidase (see paper)
75% identity, 99% coverage: 4:535/536 of query aligns to 1:533/535 of 3wy1A
- active site: D97 (= D100), R197 (= R200), D199 (= D202), E268 (= E271), H329 (= H332), D330 (= D333)
- binding glycerol: S101 (= S104), D169 (= D172), V170 (≠ L173), F203 (= F206), Y204 (= Y207), H206 (= H209)
- binding magnesium ion: D20 (= D23), D24 (= D27), V26 (= V29), D28 (= D31)
- binding (3R,5R,7R)-octane-1,3,5,7-tetracarboxylic acid: D59 (= D62), Y62 (= Y65), H102 (= H105), F144 (= F147), F163 (= F166), R197 (= R200), D199 (= D202), T200 (= T203), G225 (= G228), E268 (= E271), F294 (= F297), H329 (= H332), D330 (= D333), R397 (= R400)
3wy4A Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
75% identity, 99% coverage: 4:535/536 of query aligns to 1:533/535 of 3wy4A
- active site: D97 (= D100), R197 (= R200), D199 (= D202), Q268 (≠ E271), H329 (= H332), D330 (= D333)
- binding alpha-D-glucopyranose: D59 (= D62), Y62 (= Y65), H102 (= H105), I143 (= I146), F163 (= F166), D199 (= D202), T200 (= T203), G225 (= G228), Q268 (≠ E271), Q268 (≠ E271), F294 (= F297), H329 (= H332), D330 (= D333), R397 (= R400), R397 (= R400)
- binding glycerol: S101 (= S104), D169 (= D172), V170 (≠ L173), F203 (= F206), Y204 (= Y207), H206 (= H209), L224 (= L227), G225 (= G228), A226 (= A229), P227 (= P230), F294 (= F297), D330 (= D333), E374 (= E377), K395 (= K398), G396 (= G399), G399 (= G402)
- binding magnesium ion: D20 (= D23), D24 (= D27), V26 (= V29), D28 (= D31)
3wy4B Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
58% identity, 99% coverage: 4:535/536 of query aligns to 1:419/421 of 3wy4B
- active site: D75 (= D100), R175 (= R200), D177 (= D202), Q237 (≠ E271)
- binding glycerol: S79 (= S104), N140 (= N165), D147 (= D172), F181 (= F206), Y182 (= Y207), F183 (= F208), H184 (= H209), D209 (= D243)
2ze0A Alpha-glucosidase gsj (see paper)
38% identity, 99% coverage: 7:534/536 of query aligns to 4:527/531 of 2ze0A
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
36% identity, 91% coverage: 7:495/536 of query aligns to 2:512/559 of 4mazA
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
36% identity, 91% coverage: 7:495/536 of query aligns to 4:514/561 of O06994
- D20 (= D23) binding
- N22 (= N25) binding
- D24 (= D27) binding
- F26 (≠ V29) binding
- D28 (= D31) binding
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
36% identity, 91% coverage: 7:495/536 of query aligns to 2:512/559 of 7lv6B
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
36% identity, 91% coverage: 7:495/536 of query aligns to 2:509/556 of 5wczA
- active site: D95 (= D100), R195 (= R200), D197 (= D202), E250 (= E271), H326 (= H332), D327 (= D333)
- binding 1-deoxynojirimycin: D57 (= D62), Y60 (= Y65), H100 (= H105), F161 (= F166), D197 (= D202), V198 (≠ T203), E250 (= E271), H326 (= H332), D327 (= D333), R413 (= R400)
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
36% identity, 91% coverage: 7:495/536 of query aligns to 2:509/555 of 4m56A
- active site: D95 (= D100), R195 (= R200), D197 (= D202), E250 (= E271), H326 (= H332), D327 (= D333)
- binding D-glucose: D57 (= D62), Y60 (= Y65), H100 (= H105), F142 (= F147), D197 (= D202), E250 (= E271), D327 (= D333), R413 (= R400)
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
36% identity, 93% coverage: 7:504/536 of query aligns to 3:510/546 of 8ibkA
- binding calcium ion: D19 (= D23), N21 (= N25), D23 (= D27), I25 (≠ V29), D27 (= D31)
- binding alpha-D-glucopyranose: D58 (= D62), Y61 (= Y65), H101 (= H105), I141 (= I146), F161 (= F166), D197 (= D202), A198 (≠ T203), H201 (= H209), M227 (≠ I244), Q254 (≠ E271), Q254 (≠ E271), F280 (= F297), H320 (= H332), D321 (= D333), R405 (= R400)
Sites not aligning to the query:
7p01A Structure of the maltase baag2 from blastobotrys adeninivorans in complex with acarbose (see paper)
38% identity, 92% coverage: 4:497/536 of query aligns to 4:531/572 of 7p01A
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: D62 (= D62), Y65 (= Y65), H105 (= H105), Y150 (≠ I146), F170 (= F166), D207 (= D202), T208 (= T203), E265 (= E271), F291 (= F297), H338 (= H332), D339 (= D333), R431 (= R400), T529 (= T495), D530 (≠ G496)
- binding calcium ion: D23 (= D23), N25 (= N25), D27 (= D27), I29 (≠ V29), D31 (= D31)
- binding alpha-D-glucopyranose: R224 (= R225), F291 (= F297), A295 (vs. gap), E300 (vs. gap), S349 (= S343), D350 (≠ E344), D350 (≠ E344), A351 (≠ E345), Q427 (vs. gap), K428 (vs. gap)
- binding 1-methylpyrrolidin-2-one: S19 (≠ R19), I29 (≠ V29), M63 (≠ F63), H74 (≠ D74), W454 (= W423)
4howA The crystal structure of isomaltulose synthase from erwinia rhapontici nx5 (see paper)
35% identity, 99% coverage: 7:536/536 of query aligns to 6:557/559 of 4howA
4aieA Structure of glucan-1,6-alpha-glucosidase from lactobacillus acidophilus ncfm (see paper)
33% identity, 98% coverage: 7:531/536 of query aligns to 3:531/537 of 4aieA
4hphA The crystal structure of isomaltulose synthase mutant e295q from erwinia rhapontici nx5 in complex with its natural substrate sucrose (see paper)
35% identity, 99% coverage: 7:536/536 of query aligns to 6:557/559 of 4hphA
- active site: D99 (= D100), R198 (= R200), D200 (= D202), Q254 (≠ E271), H327 (= H332), D328 (= D333)
- binding calcium ion: D22 (= D23), N24 (= N25), D26 (= D27), I28 (≠ V29), D30 (= D31)
- binding beta-D-fructofuranose: F164 (= F166), Q254 (≠ E271), F256 (≠ G273), D328 (= D333), E387 (≠ P392), R415 (= R400)
- binding alpha-D-glucopyranose: D61 (= D62), Y64 (= Y65), H104 (= H105), F164 (= F166), D200 (= D202), Q254 (≠ E271), H327 (= H332), D328 (= D333), R415 (= R400)
4h8vA Crystal structure of the trehalulose synthase mutb in complex with trehalulose
34% identity, 99% coverage: 7:535/536 of query aligns to 6:555/557 of 4h8vA
- active site: D99 (= D100), R198 (= R200), D200 (= D202), E254 (= E271), H326 (= H332), D327 (= D333)
- binding calcium ion: D22 (= D23), N24 (= N25), D26 (= D27), I28 (≠ V29), D30 (= D31)
- binding 1-O-alpha-D-glucopyranosyl-D-fructose: D61 (= D62), Y64 (= Y65), H104 (= H105), F164 (= F166), D200 (= D202), E254 (= E271), F256 (≠ G273), R284 (vs. gap), R291 (vs. gap), H326 (= H332), D327 (= D333), E386 (≠ P392), R414 (= R400)
2pwdA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor deoxynojirmycin (see paper)
34% identity, 99% coverage: 7:535/536 of query aligns to 6:555/557 of 2pwdA
- active site: D99 (= D100), R198 (= R200), D200 (= D202), E254 (= E271), H326 (= H332), D327 (= D333)
- binding calcium ion: D22 (= D23), N24 (= N25), D26 (= D27), I28 (≠ V29), D30 (= D31)
- binding 1-deoxynojirimycin: D61 (= D62), Y64 (= Y65), H104 (= H105), F164 (= F166), D200 (= D202), E254 (= E271), H326 (= H332), D327 (= D333), R414 (= R400)
2pwgA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor castanospermine (see paper)
34% identity, 99% coverage: 7:535/536 of query aligns to 5:554/556 of 2pwgA
- active site: D98 (= D100), R197 (= R200), D199 (= D202), E253 (= E271), H325 (= H332), D326 (= D333)
- binding calcium ion: D21 (= D23), N23 (= N25), D25 (= D27), I27 (≠ V29), D29 (= D31)
- binding castanospermine: D60 (= D62), Y63 (= Y65), H103 (= H105), F163 (= F166), D199 (= D202), E253 (= E271), D326 (= D333), R413 (= R400)
4hozA The crystal structure of isomaltulose synthase mutant d241a from erwinia rhapontici nx5 in complex with d-glucose (see paper)
35% identity, 99% coverage: 7:536/536 of query aligns to 6:557/559 of 4hozA
- active site: D99 (= D100), R198 (= R200), A200 (≠ D202), E254 (= E271), H327 (= H332), D328 (= D333)
- binding calcium ion: D22 (= D23), N24 (= N25), D26 (= D27), I28 (≠ V29), D30 (= D31)
- binding alpha-D-glucopyranose: D61 (= D62), Y64 (= Y65), H104 (= H105), F164 (= F166), R198 (= R200), A200 (≠ D202), E254 (= E271), H327 (= H332), D328 (= D333), R415 (= R400)
2pweA Crystal structure of the mutb e254q mutant in complex with the substrate sucrose (see paper)
34% identity, 99% coverage: 7:535/536 of query aligns to 5:554/556 of 2pweA
- active site: D98 (= D100), R197 (= R200), D199 (= D202), Q253 (≠ E271), H325 (= H332), D326 (= D333)
- binding calcium ion: D21 (= D23), N23 (= N25), D25 (= D27), I27 (≠ V29), D29 (= D31)
- binding beta-D-fructofuranose: F163 (= F166), Q253 (≠ E271), F255 (≠ G273), D326 (= D333), R413 (= R400)
- binding alpha-D-glucopyranose: D60 (= D62), Y63 (= Y65), H103 (= H105), F163 (= F166), D199 (= D202), Q253 (≠ E271), H325 (= H332), D326 (= D333), R413 (= R400)
Query Sequence
>WP_086510096.1 NCBI__GCF_002151265.1:WP_086510096.1
MQDNTFWWRGGVIYQIYPRSFMDSNGDGVGDLPGVTERLDYVASLGVDGIWLSPFFTSPM
RDFGYDISNYRDVDPLFGTLADFKALLERAHALGLKVIIDQVISHTSDQHPWFQESRMNR
DNPRADWYVWADPNPDGTAPNNWLSIFGGPAWTFDSRRQQYYLHNFLSSQPDLNFHNPEV
RAAQLDNMRFWLELGVDGFRLDTVNFYFHDQHLRSNPALTIDATRTLGAPKENPYTWQRH
IYDISRPENVEFLRELRALMDEYPGTTTVGEIGDDTPLERMAEYTSGGDKLHMAYTFDLL
NAPRSPDYIRGVLERFQQFAGDAWPCWALSNHDVVRSATRWGSEECAFAYPRVALALLFS
LRGSVCLYQGEELGLPEAEVPFERIQDPYGLPLWPDFKGRDGCRTPMPWDDTPLAGFSDV
EPWLPVAEPHLAMSVARQQDEPDSMLNATRRLLRFRHQHPALFDGDMTLLDLGEALVAFT
RQRGSDRLLCVFNLTGQPQSATLPEVREALQEHGFQYEVSGGRLHLPPYQAAYFRF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory