SitesBLAST
Comparing WP_086510098.1 NCBI__GCF_002151265.1:WP_086510098.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wy2A Crystal structure of alpha-glucosidase in complex with glucose (see paper)
56% identity, 97% coverage: 12:542/550 of query aligns to 4:534/535 of 3wy2A
- active site: D97 (= D105), R197 (= R205), D199 (= D207), E268 (= E275), H329 (= H336), D330 (= D337)
- binding beta-D-glucopyranose: D59 (= D67), Y62 (= Y70), H102 (= H110), R197 (= R205), D199 (= D207), E268 (= E275), H329 (= H336), D330 (= D337), R397 (= R403)
- binding glycerol: S101 (= S109), D169 (= D177), V170 (≠ L178), P175 (= P183), R178 (≠ V186), Q179 (≠ E187), F203 (= F211), Y204 (≠ C212), H206 (= H214), D240 (= D247), P244 (= P251), E280 (= E287)
- binding magnesium ion: D20 (= D28), R22 (= R30), V26 (≠ I34), D28 (= D36)
3wy1A Crystal structure of alpha-glucosidase (see paper)
56% identity, 97% coverage: 12:542/550 of query aligns to 4:534/535 of 3wy1A
- active site: D97 (= D105), R197 (= R205), D199 (= D207), E268 (= E275), H329 (= H336), D330 (= D337)
- binding glycerol: S101 (= S109), D169 (= D177), V170 (≠ L178), F203 (= F211), Y204 (≠ C212), H206 (= H214)
- binding magnesium ion: D20 (= D28), D24 (≠ A32), V26 (≠ I34), D28 (= D36)
- binding (3R,5R,7R)-octane-1,3,5,7-tetracarboxylic acid: D59 (= D67), Y62 (= Y70), H102 (= H110), F144 (= F152), F163 (= F171), R197 (= R205), D199 (= D207), T200 (≠ A208), G225 (= G232), E268 (= E275), F294 (= F301), H329 (= H336), D330 (= D337), R397 (= R403)
3wy4A Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
55% identity, 97% coverage: 12:542/550 of query aligns to 4:534/535 of 3wy4A
- active site: D97 (= D105), R197 (= R205), D199 (= D207), Q268 (≠ E275), H329 (= H336), D330 (= D337)
- binding alpha-D-glucopyranose: D59 (= D67), Y62 (= Y70), H102 (= H110), I143 (= I151), F163 (= F171), D199 (= D207), T200 (≠ A208), G225 (= G232), Q268 (≠ E275), Q268 (≠ E275), F294 (= F301), H329 (= H336), D330 (= D337), R397 (= R403), R397 (= R403)
- binding glycerol: S101 (= S109), D169 (= D177), V170 (≠ L178), F203 (= F211), Y204 (≠ C212), H206 (= H214), L224 (≠ I231), G225 (= G232), A226 (≠ V233), P227 (≠ R234), F294 (= F301), D330 (= D337), E374 (= E380), K395 (= K401), G396 (= G402), G399 (= G405)
- binding magnesium ion: D20 (= D28), D24 (≠ A32), V26 (≠ I34), D28 (= D36)
3wy4B Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
54% identity, 66% coverage: 12:375/550 of query aligns to 4:323/421 of 3wy4B
- active site: D75 (= D105), R175 (= R205), D177 (= D207), Q237 (≠ E275)
- binding glycerol: S79 (= S109), N140 (= N170), D147 (= D177), F181 (= F211), Y182 (≠ C212), F183 (≠ T213), H184 (= H214), D209 (= D247)
2ze0A Alpha-glucosidase gsj (see paper)
40% identity, 89% coverage: 12:503/550 of query aligns to 4:487/531 of 2ze0A
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
35% identity, 94% coverage: 11:527/550 of query aligns to 1:531/559 of 4mazA
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
35% identity, 94% coverage: 11:527/550 of query aligns to 1:531/559 of 7lv6B
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
35% identity, 94% coverage: 11:527/550 of query aligns to 3:533/561 of O06994
- D20 (= D28) binding
- N22 (≠ R30) binding
- D24 (≠ A32) binding
- F26 (≠ I34) binding
- D28 (= D36) binding
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
35% identity, 94% coverage: 11:527/550 of query aligns to 1:528/555 of 4m56A
- active site: D95 (= D105), R195 (= R205), D197 (= D207), E250 (= E275), H326 (= H336), D327 (= D337)
- binding D-glucose: D57 (= D67), Y60 (= Y70), H100 (= H110), F142 (= F152), D197 (= D207), E250 (= E275), D327 (= D337), R413 (= R403)
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
35% identity, 94% coverage: 11:527/550 of query aligns to 1:528/556 of 5wczA
- active site: D95 (= D105), R195 (= R205), D197 (= D207), E250 (= E275), H326 (= H336), D327 (= D337)
- binding 1-deoxynojirimycin: D57 (= D67), Y60 (= Y70), H100 (= H110), F161 (= F171), D197 (= D207), V198 (≠ A208), E250 (= E275), H326 (= H336), D327 (= D337), R413 (= R403)
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
35% identity, 83% coverage: 12:469/550 of query aligns to 3:470/546 of 8ibkA
- binding calcium ion: D19 (= D28), N21 (≠ R30), D23 (≠ A32), I25 (= I34), D27 (= D36)
- binding alpha-D-glucopyranose: D58 (= D67), Y61 (= Y70), H101 (= H110), I141 (= I151), F161 (= F171), D197 (= D207), A198 (= A208), H201 (≠ F211), M227 (≠ L245), Q254 (≠ E275), Q254 (≠ E275), F280 (= F301), H320 (= H336), D321 (= D337), R405 (= R403)
Sites not aligning to the query:
4h8vA Crystal structure of the trehalulose synthase mutb in complex with trehalulose
36% identity, 90% coverage: 12:508/550 of query aligns to 6:519/557 of 4h8vA
- active site: D99 (= D105), R198 (= R205), D200 (= D207), E254 (= E275), H326 (= H336), D327 (= D337)
- binding calcium ion: D22 (= D28), N24 (≠ R30), D26 (≠ A32), I28 (= I34), D30 (= D36)
- binding 1-O-alpha-D-glucopyranosyl-D-fructose: D61 (= D67), Y64 (= Y70), H104 (= H110), F164 (= F171), D200 (= D207), E254 (= E275), F256 (≠ G277), R284 (≠ T305), R291 (vs. gap), H326 (= H336), D327 (= D337), E386 (≠ A392), R414 (= R403)
2pwdA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor deoxynojirmycin (see paper)
36% identity, 90% coverage: 12:508/550 of query aligns to 6:519/557 of 2pwdA
- active site: D99 (= D105), R198 (= R205), D200 (= D207), E254 (= E275), H326 (= H336), D327 (= D337)
- binding calcium ion: D22 (= D28), N24 (≠ R30), D26 (≠ A32), I28 (= I34), D30 (= D36)
- binding 1-deoxynojirimycin: D61 (= D67), Y64 (= Y70), H104 (= H110), F164 (= F171), D200 (= D207), E254 (= E275), H326 (= H336), D327 (= D337), R414 (= R403)
2pwgA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor castanospermine (see paper)
36% identity, 90% coverage: 12:508/550 of query aligns to 5:518/556 of 2pwgA
- active site: D98 (= D105), R197 (= R205), D199 (= D207), E253 (= E275), H325 (= H336), D326 (= D337)
- binding calcium ion: D21 (= D28), N23 (≠ R30), D25 (≠ A32), I27 (= I34), D29 (= D36)
- binding castanospermine: D60 (= D67), Y63 (= Y70), H103 (= H110), F163 (= F171), D199 (= D207), E253 (= E275), D326 (= D337), R413 (= R403)
2pweA Crystal structure of the mutb e254q mutant in complex with the substrate sucrose (see paper)
35% identity, 90% coverage: 12:508/550 of query aligns to 5:518/556 of 2pweA
- active site: D98 (= D105), R197 (= R205), D199 (= D207), Q253 (≠ E275), H325 (= H336), D326 (= D337)
- binding calcium ion: D21 (= D28), N23 (≠ R30), D25 (≠ A32), I27 (= I34), D29 (= D36)
- binding beta-D-fructofuranose: F163 (= F171), Q253 (≠ E275), F255 (≠ G277), D326 (= D337), R413 (= R403)
- binding alpha-D-glucopyranose: D60 (= D67), Y63 (= Y70), H103 (= H110), F163 (= F171), D199 (= D207), Q253 (≠ E275), H325 (= H336), D326 (= D337), R413 (= R403)
2pwfA Crystal structure of the mutb d200a mutant in complex with glucose (see paper)
35% identity, 90% coverage: 12:508/550 of query aligns to 4:517/555 of 2pwfA
- active site: D97 (= D105), R196 (= R205), A198 (≠ D207), E252 (= E275), H324 (= H336), D325 (= D337)
- binding beta-D-glucopyranose: D59 (= D67), Y62 (= Y70), H102 (= H110), F162 (= F171), R196 (= R205), A198 (≠ D207), E252 (= E275), H324 (= H336), D325 (= D337), R412 (= R403)
- binding calcium ion: D20 (= D28), N22 (≠ R30), D24 (≠ A32), I26 (= I34), D28 (= D36)
4ha1A Mutb inactive double mutant d200a-d415n in complex with isomaltulose
35% identity, 90% coverage: 12:508/550 of query aligns to 5:518/556 of 4ha1A
- active site: D98 (= D105), R197 (= R205), A199 (≠ D207), E253 (= E275), H325 (= H336), D326 (= D337)
- binding calcium ion: D21 (= D28), N23 (≠ R30), D25 (≠ A32), I27 (= I34), D29 (= D36)
- binding 6-O-alpha-D-glucopyranosyl-D-fructose: D60 (= D67), Y63 (= Y70), H103 (= H110), F163 (= F171), E253 (= E275), R283 (≠ T305), H325 (= H336), D326 (= D337), E385 (≠ A392), R413 (= R403)
7p01A Structure of the maltase baag2 from blastobotrys adeninivorans in complex with acarbose (see paper)
36% identity, 89% coverage: 12:500/550 of query aligns to 7:530/572 of 7p01A
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: D62 (= D67), Y65 (= Y70), H105 (= H110), Y150 (≠ I151), F170 (= F171), D207 (= D207), T208 (≠ A208), E265 (= E275), F291 (= F301), H338 (= H336), D339 (= D337), R431 (= R403), T529 (≠ A499), D530 (≠ N500)
- binding calcium ion: D23 (= D28), N25 (≠ R30), D27 (≠ A32), I29 (= I34), D31 (= D36)
- binding alpha-D-glucopyranose: R224 (= R223), F291 (= F301), A295 (≠ L304), E300 (≠ T309), S349 (= S349), D350 (= D350), D350 (= D350), A351 (≠ M351), Q427 (vs. gap), K428 (vs. gap)
- binding 1-methylpyrrolidin-2-one: S19 (≠ R24), I29 (= I34), M63 (≠ F68), H74 (≠ D79), W454 (= W427)
5brpA Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea), mutant r201q, in complex with png (see paper)
34% identity, 91% coverage: 12:510/550 of query aligns to 3:516/555 of 5brpA
- active site: D96 (= D105), Q196 (≠ R205), D198 (= D207), E249 (= E275), H323 (= H336), D324 (= D337)
- binding magnesium ion: D19 (= D28), T21 (≠ R30), N23 (≠ A32), V25 (≠ I34), D27 (= D36)
- binding 4-nitrophenyl alpha-D-glucopyranoside: D58 (= D67), N59 (≠ F68), Y61 (= Y70), H101 (= H110), Y162 (≠ F171), D198 (= D207), V199 (≠ A208), E249 (= E275)
4howA The crystal structure of isomaltulose synthase from erwinia rhapontici nx5 (see paper)
33% identity, 91% coverage: 10:510/550 of query aligns to 4:522/559 of 4howA
Query Sequence
>WP_086510098.1 NCBI__GCF_002151265.1:WP_086510098.1
MAIRQLGGDPDWWRGAVIYQIYPRSFQDSRGAGIGDLQGVIDRLDYIASLNVDAIWLAPF
FTSPMKDFGYDVSDYRGVDPTFGTLDDFDRLVEAAHARGLRVTIDQVLSHSSDQHPWFAE
SRSSRDNPKADWYVWADARSDGSPPTNWQAIFGGSAWQWDTRRCQYYLHNFLVEQPDLNF
HNPEVVEAILEEVRFWLERGVDGFRLDAVNFCTHGPLKDNPPREKIVEGFIGVRPDNPYA
FQRHLYDKTQPENLAFLERLRALLDEYPSTTTIGEVGDDDSLGVMSEYTQGGKRLHMCYS
FNLLTDKATPADLLAPLTEMEARIGDGWPCWAVGNHDITRVATRWNVASDMAKLRLYLAF
LLTQRGSICLYQGEELGLTEAELTFEQLVDPAGITFWPSYKGRDGCRTPMPWVADALHGG
FTTATPWLPVPEAHLALAVDRQERDPGSLLNAYRDFLLFRRNQPALVKGDIHYHPLQGDV
ICFERLHGDDRLLVALNFANDPCTLSAPLDARPLAGAPSLVNGRWTAERLELPAFGIAIA
RCPSDLPWQP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory