Comparing WP_086510099.1 NCBI__GCF_002151265.1:WP_086510099.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6jahA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with glucose (see paper)
48% identity, 91% coverage: 36:426/429 of query aligns to 10:400/404 of 6jahA
6jagA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with sucrose (see paper)
48% identity, 91% coverage: 36:426/429 of query aligns to 10:400/404 of 6jagA
Sites not aligning to the query:
6jadA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with palatinose (see paper)
48% identity, 91% coverage: 36:426/429 of query aligns to 10:400/404 of 6jadA
Sites not aligning to the query:
6j9yA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with maltose (see paper)
48% identity, 91% coverage: 36:426/429 of query aligns to 10:400/404 of 6j9yA
Sites not aligning to the query:
6jamA Crystal structure of abc transporter alpha-glycoside-binding mutant protein r356a in complex with trehalose (see paper)
48% identity, 91% coverage: 36:426/429 of query aligns to 12:402/406 of 6jamA
Sites not aligning to the query:
6jaiA Crystal structure of abc transporter alpha-glycoside-binding mutant protein d118a in complex with maltose (see paper)
48% identity, 91% coverage: 36:426/429 of query aligns to 10:400/404 of 6jaiA
6jb0A Crystal structure of abc transporter alpha-glycoside-binding mutant protein w287a in complex with trehalose (see paper)
48% identity, 91% coverage: 36:426/429 of query aligns to 10:400/404 of 6jb0A
Sites not aligning to the query:
6dtqA Maltose bound t. Maritima male3 (see paper)
42% identity, 84% coverage: 62:422/429 of query aligns to 33:388/391 of 6dtqA
Sites not aligning to the query:
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
41% identity, 80% coverage: 83:427/429 of query aligns to 56:407/407 of 1eu8A
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
41% identity, 80% coverage: 83:427/429 of query aligns to 97:448/450 of Q7LYW7
Sites not aligning to the query:
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
30% identity, 98% coverage: 6:426/429 of query aligns to 4:416/416 of A9CEY9
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
32% identity, 86% coverage: 56:426/429 of query aligns to 27:388/389 of 7ofyA
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
32% identity, 86% coverage: 56:424/429 of query aligns to 25:384/384 of 7yzsAAA
Sites not aligning to the query:
7qhvAAA Sulfoquinovosyl binding protein (see paper)
32% identity, 86% coverage: 56:426/429 of query aligns to 26:386/390 of 7qhvAAA
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
32% identity, 86% coverage: 56:424/429 of query aligns to 24:381/382 of 7yzuA
Sites not aligning to the query:
8s5bA Sulfoquinovosyl glycerol-binding protein SmoF (see paper)
32% identity, 86% coverage: 56:424/429 of query aligns to 20:376/377 of 8s5bA
5ci5A Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
25% identity, 71% coverage: 122:424/429 of query aligns to 94:390/393 of 5ci5A
Sites not aligning to the query:
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
23% identity, 91% coverage: 34:424/429 of query aligns to 7:398/399 of 5iaiA
5ysdB Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
24% identity, 79% coverage: 42:381/429 of query aligns to 10:338/389 of 5ysdB
5ysdA Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
24% identity, 79% coverage: 42:381/429 of query aligns to 10:338/387 of 5ysdA
>WP_086510099.1 NCBI__GCF_002151265.1:WP_086510099.1
MTCFSRTTLARQVLFGALVASGLTLVTTQAQAATITIACGDGGSADFCPELARQWAQETG
HEVAVVTTPQSGTETLSLYQQLLGSKSSDIDVLMVDTVWPGLLAAHLIDLADYLPEDASE
GFFPAMIDNNTVDDRLLALPWYSDAGLLYYRRDLLEKYDHDVPETWEQLTEIAREIQNAE
REAGNERMHGFVFQGRAYEGLTTNALEWIASYGGGTIVDDDGNITVNNPQAAEALTLAAS
WVGDIAPRGVRNYMEEEARGLFQSGNAVFMRNWPYAWALGQADGTAIQGKFGVAPLPHGS
AGESVATLGGWSWAVSRYSKNPDLAAELVAYLTAEAQQKAHAIRFGMNPTRVTLYQDKEV
LEVQPFIGELYDTLVSGVPRPANVTGEHYTRVSNAFFNRVHDVLSGDLTAEQALGQLERE
LNRISRRGW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory