SitesBLAST
Comparing WP_086510166.1 NCBI__GCF_002151265.1:WP_086510166.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
34% identity, 95% coverage: 11:254/257 of query aligns to 6:255/258 of 3ak4A
- active site: G18 (= G23), S141 (= S140), L151 (≠ R150), Y154 (= Y153), K158 (= K157), E199 (≠ R198)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ N22), G18 (= G23), I19 (= I24), D38 (= D43), L39 (≠ V44), V60 (≠ A61), D61 (= D62), V62 (= V63), N88 (= N88), A89 (= A89), G90 (= G90), T139 (≠ M138), S141 (= S140), Y154 (= Y153), K158 (= K157), G185 (= G184), V187 (= V186), T189 (≠ G188), M191 (≠ R190)
1xr3A Actinorhodin polyketide ketoreductase with NADP and the inhibitor isoniazid bound (see paper)
37% identity, 92% coverage: 16:251/257 of query aligns to 5:250/256 of 1xr3A
- active site: G12 (= G23), N109 (= N113), S139 (= S140), Y152 (= Y153), K156 (= K157), Y197 (≠ R198)
- binding 4-(diazenylcarbonyl)pyridine: T140 (≠ V141), G141 (≠ A142), V146 (≠ F147)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (≠ A19), T10 (≠ A21), S11 (≠ N22), G12 (= G23), I13 (= I24), A32 (≠ D43), R33 (≠ V44), G34 (≠ D45), C57 (vs. gap), D58 (vs. gap), V59 (≠ T59), N85 (= N88), A86 (= A89), G87 (= G90), S139 (= S140), Y152 (= Y153), K156 (= K157), G183 (= G184), V185 (= V186), T187 (≠ G188), P188 (= P189)
1w4zA Structure of actinorhodin polyketide (actiii) reductase (see paper)
37% identity, 92% coverage: 16:251/257 of query aligns to 8:253/259 of 1w4zA
- active site: G15 (= G23), N112 (= N113), S142 (= S140), Y155 (= Y153), K159 (= K157), Y200 (≠ R198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (≠ A19), T13 (≠ A21), S14 (≠ N22), G15 (= G23), I16 (= I24), R36 (≠ V44), G37 (≠ D45), D61 (vs. gap), V62 (≠ T59), N88 (= N88), G90 (= G90), S142 (= S140), Y155 (= Y153), K159 (= K157), P185 (= P183), G186 (= G184), V188 (= V186), T190 (≠ G188)
2rh4B Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
37% identity, 92% coverage: 16:251/257 of query aligns to 17:262/268 of 2rh4B
- active site: G24 (= G23), N121 (= N113), S151 (= S140), Y164 (= Y153), K168 (= K157), Y209 (≠ R198)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (≠ A19), T22 (≠ A21), S23 (≠ N22), I25 (= I24), A44 (≠ D43), R45 (≠ V44), G46 (≠ D45), C69 (vs. gap), D70 (vs. gap), V71 (≠ T59), N97 (= N88), S151 (= S140), Y164 (= Y153), K168 (= K157), G195 (= G184), V197 (= V186), T199 (≠ G188), M201 (≠ R190)
P16544 Putative ketoacyl reductase; EC 1.3.1.- from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
37% identity, 92% coverage: 16:251/257 of query aligns to 10:255/261 of P16544
- 11:39 (vs. 17:45, 45% identical) binding
- D63 (vs. gap) binding
- K161 (= K157) binding
2rh4A Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
37% identity, 92% coverage: 16:251/257 of query aligns to 6:251/257 of 2rh4A
- active site: G13 (= G23), N110 (= N113), S140 (= S140), Y153 (= Y153), K157 (= K157), Y198 (≠ R198)
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: T141 (≠ V141), Q145 (≠ L145), V147 (≠ F147), Y153 (= Y153), F185 (≠ I185)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (≠ A19), T11 (≠ A21), S12 (≠ N22), G13 (= G23), I14 (= I24), A33 (≠ D43), R34 (≠ V44), G35 (≠ D45), C58 (vs. gap), D59 (vs. gap), V60 (≠ T59), N86 (= N88), G88 (= G90), S140 (= S140), Y153 (= Y153), K157 (= K157), P183 (= P183), G184 (= G184), V186 (= V186), T188 (≠ G188), M190 (≠ R190)
Sites not aligning to the query:
5t5qC Crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
35% identity, 92% coverage: 14:250/257 of query aligns to 8:238/245 of 5t5qC
- active site: G18 (vs. gap), S140 (= S140), N150 (≠ R150), Y153 (= Y153), K157 (= K157)
- binding nicotinamide-adenine-dinucleotide: N16 (= N22), G17 (= G23), G18 (vs. gap), I19 (= I24), D38 (= D43), L39 (≠ V44), D63 (= D62), A64 (≠ V63), S90 (≠ N88), I113 (= I112), Y153 (= Y153), K157 (= K157), P182 (= P183), I185 (≠ V186), T187 (≠ G188), M189 (≠ R190)
3sjuA Hedamycin polyketide ketoreductase bound to NADPH (see paper)
34% identity, 92% coverage: 16:251/257 of query aligns to 4:249/255 of 3sjuA
- active site: G11 (= G23), S138 (= S140), Y151 (= Y153), K155 (= K157), Y196 (≠ R198)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (≠ A19), S10 (≠ N22), A31 (≠ D43), R32 (≠ V44), D33 (= D45), C56 (≠ E68), D57 (≠ V69), V58 (≠ A70), S84 (≠ N88), A85 (= A89), G86 (= G90), I136 (≠ M138), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), Y183 (≠ I185), V184 (= V186), T186 (≠ G188), M188 (≠ R190)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
38% identity, 92% coverage: 15:250/257 of query aligns to 8:232/240 of 2d1yA
- active site: G16 (= G23), S135 (= S140), N145 (≠ R150), Y148 (= Y153), K152 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A19), R15 (≠ N22), I17 (= I24), D36 (= D43), L37 (≠ V44), R38 (vs. gap), V55 (≠ A61), D56 (= D62), L57 (≠ V63), N83 (= N88), A84 (= A89), A85 (≠ G90), I86 (= I91), V133 (≠ M138), S135 (= S140), Y148 (= Y153), K152 (= K157), P178 (= P183), G179 (= G184), I181 (= I195), T183 (≠ D197), A185 (= A199), V186 (≠ A200)
6gtuA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with fragment j6
38% identity, 81% coverage: 30:237/257 of query aligns to 24:230/268 of 6gtuA
- active site: S138 (= S140), Y151 (= Y153), K155 (= K157)
- binding N-(1,3-benzodioxol-5-ylmethyl)cyclopentanamine: N183 (≠ I185)
- binding nicotinamide-adenine-dinucleotide: D37 (= D43), K38 (≠ V44), D59 (= D62), N86 (= N88), A87 (= A89), G88 (= G90), L110 (≠ I112), S138 (= S140), Y151 (= Y153), K155 (= K157), G182 (= G184), I184 (≠ V186), T186 (≠ G188), L188 (≠ R190)
Sites not aligning to the query:
6emmA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with salicylic acid
38% identity, 81% coverage: 30:237/257 of query aligns to 24:230/268 of 6emmA
- active site: S138 (= S140), Y151 (= Y153), K155 (= K157)
- binding nicotinamide-adenine-dinucleotide: D37 (= D43), K38 (≠ V44), D59 (= D62), N86 (= N88), A87 (= A89), G88 (= G90), L110 (≠ I112), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), I184 (≠ V186), T186 (≠ G188), L188 (≠ R190)
Sites not aligning to the query:
5hs6A Human 17beta-hydroxysteroid dehydrogenase type 14 in complex with estrone (see paper)
38% identity, 81% coverage: 30:237/257 of query aligns to 24:230/257 of 5hs6A
- active site: S138 (= S140), A148 (≠ R150), Y151 (= Y153), K155 (= K157)
- binding (9beta,13alpha)-3-hydroxyestra-1,3,5(10)-trien-17-one: H90 (≠ A92), Q145 (≠ F147), Y151 (= Y153), L192 (≠ V194)
- binding nicotinamide-adenine-dinucleotide: D37 (= D43), K38 (≠ V44), D59 (= D62), N86 (= N88), L110 (≠ I112), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), N183 (≠ I185), I184 (≠ V186), T186 (≠ G188), L188 (≠ R190)
Sites not aligning to the query:
6gtbA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with fb211
38% identity, 81% coverage: 30:237/257 of query aligns to 24:230/257 of 6gtbA
- active site: S138 (= S140), Y151 (= Y153), K155 (= K157)
- binding beta-D-glucopyranose: W185 (≠ R187), T186 (≠ G188), P187 (= P189), E190 (= E192)
- binding 3-[6-(3-hydroxyphenyl)pyridin-2-yl]benzoic acid: H90 (≠ A92), P93 (≠ T95), S138 (= S140), Q145 (≠ F147), A146 (= A148), Q147 (≠ Y149), Y151 (= Y153), W189 (≠ I191), L192 (≠ V194), M196 (≠ R198)
- binding nicotinamide-adenine-dinucleotide: D37 (= D43), K38 (≠ V44), D59 (= D62), V60 (= V63), N86 (= N88), L110 (≠ I112), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), N183 (≠ I185), I184 (≠ V186), T186 (≠ G188), L188 (≠ R190)
Sites not aligning to the query:
5o7cA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal quinoline based inhibitor (see paper)
38% identity, 81% coverage: 30:237/257 of query aligns to 24:230/257 of 5o7cA
- active site: S138 (= S140), Y151 (= Y153), K155 (= K157)
- binding 2-(4-fluoranyl-3-oxidanyl-phenyl)carbonylquinoline-7-carbonitrile: H90 (≠ A92), P93 (≠ T95), S138 (= S140), Y151 (= Y153), N183 (≠ I185), W189 (≠ I191), L192 (≠ V194), T202 (≠ I204)
- binding beta-D-glucopyranose: W185 (≠ R187), T186 (≠ G188), P187 (= P189), E190 (= E192)
- binding nicotinamide-adenine-dinucleotide: D37 (= D43), K38 (≠ V44), D59 (= D62), V60 (= V63), N86 (= N88), A87 (= A89), L110 (≠ I112), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), N183 (≠ I185), I184 (≠ V186), T186 (≠ G188), L188 (≠ R190)
Sites not aligning to the query:
5o6zA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal quinoline based inhibitor (see paper)
38% identity, 81% coverage: 30:237/257 of query aligns to 24:230/257 of 5o6zA
- active site: S138 (= S140), Y151 (= Y153), K155 (= K157)
- binding (4-fluoranyl-3-oxidanyl-phenyl)-quinolin-2-yl-methanone: H90 (≠ A92), S138 (= S140), Y151 (= Y153), N183 (≠ I185), W189 (≠ I191), L192 (≠ V194)
- binding beta-D-glucopyranose: W185 (≠ R187), T186 (≠ G188), P187 (= P189), E190 (= E192)
- binding nicotinamide-adenine-dinucleotide: D37 (= D43), K38 (≠ V44), D59 (= D62), V60 (= V63), N86 (= N88), L110 (≠ I112), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), I184 (≠ V186), T186 (≠ G188), L188 (≠ R190)
Sites not aligning to the query:
5o6xA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal quinoline based inhibitor (see paper)
38% identity, 81% coverage: 30:237/257 of query aligns to 23:229/253 of 5o6xA
- active site: S137 (= S140), Y150 (= Y153), K154 (= K157)
- binding (4-fluoranyl-3-oxidanyl-phenyl)-(6-methylquinolin-2-yl)methanone: H89 (≠ A92), S137 (= S140), L138 (≠ V141), V139 (≠ A142), Q144 (≠ F147), G181 (= G184), N182 (≠ I185), W188 (≠ I191), L191 (≠ V194)
- binding beta-D-glucopyranose: W184 (≠ R187), T185 (≠ G188), P186 (= P189), E189 (= E192)
- binding nicotinamide-adenine-dinucleotide: D36 (= D43), K37 (≠ V44), D58 (= D62), V59 (= V63), N85 (= N88), G87 (= G90), L109 (≠ I112), S137 (= S140), Y150 (= Y153), K154 (= K157), P180 (= P183), G181 (= G184), I183 (≠ V186), T185 (≠ G188), L187 (≠ R190)
Sites not aligning to the query:
5icmA 17beta-hydroxysteroid dehydrogenase type 14 in complex with a non- steroidal inhibitor (see paper)
38% identity, 81% coverage: 30:237/257 of query aligns to 23:229/255 of 5icmA
- active site: S137 (= S140), A147 (≠ R150), Y150 (= Y153), K154 (= K157)
- binding [6-(3,4-dihydroxyphenyl)pyridin-2-yl](4-fluoro-3-hydroxyphenyl)methanone: H89 (≠ A92), P92 (≠ T95), S137 (= S140), Q144 (≠ F147), A145 (= A148), Q146 (≠ Y149), Y150 (= Y153), N182 (≠ I185), W188 (≠ I191), L191 (≠ V194)
- binding alpha-D-glucopyranose: W184 (≠ R187), T185 (≠ G188), P186 (= P189), E189 (= E192)
- binding nicotinamide-adenine-dinucleotide: D36 (= D43), K37 (≠ V44), D58 (= D62), V59 (= V63), N85 (= N88), L109 (≠ I112), S137 (= S140), Y150 (= Y153), K154 (= K157), P180 (= P183), G181 (= G184), N182 (≠ I185), I183 (≠ V186), T185 (≠ G188), L187 (≠ R190)
Sites not aligning to the query:
5o43A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal 2,6-pyridinketone inhibitor. (see paper)
38% identity, 81% coverage: 30:237/257 of query aligns to 24:230/253 of 5o43A
- active site: S138 (= S140), Y151 (= Y153), K155 (= K157)
- binding 2-fluoranyl-3-[6-[(4-fluoranyl-3-oxidanyl-phenyl)-methyl-amino]pyridin-2-yl]phenol: H90 (≠ A92), S138 (= S140), Q145 (≠ F147), A146 (= A148), Q147 (≠ Y149), Y151 (= Y153), N183 (≠ I185), W189 (≠ I191), L192 (≠ V194)
- binding beta-D-glucopyranose: W185 (≠ R187), T186 (≠ G188), P187 (= P189), E190 (= E192)
- binding nicotinamide-adenine-dinucleotide: D37 (= D43), K38 (≠ V44), D59 (= D62), V60 (= V63), N86 (= N88), L110 (≠ I112), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), N183 (≠ I185), I184 (≠ V186), T186 (≠ G188), L188 (≠ R190)
Sites not aligning to the query:
5o6oA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal 2,6-pyridinketone inhibitor (see paper)
38% identity, 81% coverage: 30:237/257 of query aligns to 24:230/256 of 5o6oA
- active site: S138 (= S140), Y151 (= Y153), K155 (= K157)
- binding 2-fluoranyl-3-[6-(4-fluoranyl-3-oxidanyl-phenoxy)pyridin-2-yl]phenol: H90 (≠ A92), S138 (= S140), Q145 (≠ F147), A146 (= A148), Q147 (≠ Y149), Y151 (= Y153), N183 (≠ I185), W189 (≠ I191), L192 (≠ V194)
- binding beta-D-glucopyranose: W185 (≠ R187), T186 (≠ G188), P187 (= P189), E190 (= E192)
- binding nicotinamide-adenine-dinucleotide: D37 (= D43), K38 (≠ V44), D59 (= D62), V60 (= V63), N86 (= N88), L110 (≠ I112), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), N183 (≠ I185), I184 (≠ V186), T186 (≠ G188), L188 (≠ R190)
Sites not aligning to the query:
5o42A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal 2,6-pyridinketone inhibitor. (see paper)
38% identity, 81% coverage: 30:237/257 of query aligns to 24:230/256 of 5o42A
- active site: S138 (= S140), Y151 (= Y153), K155 (= K157)
- binding 2-fluoranyl-3-[6-[1-(4-fluoranyl-3-oxidanyl-phenyl)ethenyl]pyridin-2-yl]phenol: H90 (≠ A92), P93 (≠ T95), S138 (= S140), Q145 (≠ F147), A146 (= A148), Y151 (= Y153), N183 (≠ I185), W189 (≠ I191), L192 (≠ V194)
- binding beta-D-glucopyranose: W185 (≠ R187), T186 (≠ G188), P187 (= P189), E190 (= E192)
- binding nicotinamide-adenine-dinucleotide: D37 (= D43), K38 (≠ V44), D59 (= D62), V60 (= V63), N86 (= N88), G88 (= G90), L110 (≠ I112), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), N183 (≠ I185), I184 (≠ V186), T186 (≠ G188), L188 (≠ R190)
Sites not aligning to the query:
Query Sequence
>WP_086510166.1 NCBI__GCF_002151265.1:WP_086510166.1
MKVVDSLIPRQGLRVLVTAGANGIGLAIAQAFHEAGARVHVCDVDEAALAALPEGIAATR
ADVSREAEVARLFDEAAGLGGLDVVVNNAGIAGPTAGIDEIESEAWRQTIDINLNGQYYV
AKRAAGALRESRGVLLNMASVAGRLGFAYRTPYAASKWGVVGLTKSLACELGPAGVRVNA
ILPGIVRGPRIERVIADRAAQRGIGRDEMEQENLAKVSMRKMVEPSDIAAMALFLASPGG
ANISGQALSVCANVESL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory