SitesBLAST
Comparing WP_086510216.1 NCBI__GCF_002151265.1:WP_086510216.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5i92F Crystal structure of glutamate-1-semialdehyde 2,1- aminomutase (gsa) from pseudomonas aeruginosa
67% identity, 56% coverage: 328:751/754 of query aligns to 1:419/420 of 5i92F
Sites not aligning to the query:
P23893 Glutamate-1-semialdehyde 2,1-aminomutase; GSA; Glutamate-1-semialdehyde aminotransferase; GSA-AT; EC 5.4.3.8 from Escherichia coli (strain K12) (see paper)
63% identity, 56% coverage: 328:753/754 of query aligns to 1:426/426 of P23893
- K265 (= K592) mutation to R: 2% of wild-type activity.
6w80A Crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from stenotrophomonas maltophilia k279a in complex with plp
63% identity, 56% coverage: 318:743/754 of query aligns to 3:419/430 of 6w80A
- active site: V26 (= V346), Y149 (= Y469), D241 (= D564), K269 (= K592)
- binding pyridoxal-5'-phosphate: S121 (= S441), G122 (= G442), T123 (= T443), Y149 (= Y469), H150 (= H470), E208 (= E531), N213 (= N536), D241 (= D564), V243 (= V566), K269 (= K592)
3bs8A Crystal structure of glutamate 1-semialdehyde aminotransferase complexed with pyridoxamine-5'-phosphate from bacillus subtilis (see paper)
55% identity, 56% coverage: 331:753/754 of query aligns to 7:427/430 of 3bs8A
- active site: V22 (= V346), Y145 (= Y469), E207 (= E531), D240 (= D564), M243 (= M567), K268 (= K592), G401 (≠ A727)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G118 (= G442), T119 (= T443), Y145 (= Y469), H146 (= H470), E207 (= E531), N212 (= N536), D240 (= D564), V242 (= V566), K268 (= K592)
Q42522 Glutamate-1-semialdehyde 2,1-aminomutase 2, chloroplastic; GSA 2; Glutamate-1-semialdehyde aminotransferase 2; GSA-AT 2; EC 5.4.3.8 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
54% identity, 57% coverage: 323:753/754 of query aligns to 43:472/472 of Q42522
- R92 (≠ F372) mutation to K: In gsa2-1; suppression of enf1 mutant pleiotropic developmental phenotypes; when associated with S-162.
- G162 (= G442) mutation to S: In gsa2-1; suppression of enf1 mutant pleiotropic developmental phenotypes; when associated with K-92.
P42799 Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic; AtGSA1; GSA 1; Glutamate-1-semialdehyde aminotransferase 1; GSA-AT 1; EC 5.4.3.8 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
50% identity, 61% coverage: 291:753/754 of query aligns to 14:474/474 of P42799
- K314 (= K592) modified: N6-(pyridoxal phosphate)lysine
5hdmB Crystal structure of arabidopsis thaliana glutamate-1-semialdehyde-2, 1-aminomutase (see paper)
53% identity, 56% coverage: 328:753/754 of query aligns to 4:428/428 of 5hdmB
- active site: V22 (= V346), Y145 (= Y469), E207 (= E531), D240 (= D564), M243 (= M567), K268 (= K592), A402 (= A727)
- binding pyridoxal-5'-phosphate: G118 (= G442), T119 (= T443), Y145 (= Y469), E207 (= E531), N212 (= N536), D240 (= D564), V242 (= V566), M243 (= M567), K268 (= K592)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G118 (= G442), T119 (= T443), Y145 (= Y469), E207 (= E531), N212 (= N536), D240 (= D564), V242 (= V566), M243 (= M567), K268 (= K592)
5hdmA Crystal structure of arabidopsis thaliana glutamate-1-semialdehyde-2, 1-aminomutase (see paper)
53% identity, 56% coverage: 328:753/754 of query aligns to 4:428/428 of 5hdmA
- active site: V22 (= V346), Y145 (= Y469), E207 (= E531), D240 (= D564), M243 (= M567), K268 (= K592), A402 (= A727)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G118 (= G442), T119 (= T443), Y145 (= Y469), G147 (= G471), E207 (= E531), N212 (= N536), D240 (= D564), V242 (= V566), K268 (= K592)
2gsaB Crystal structure of glutamate-1-semialdehyde aminomutase (aminotransferase, wild-type form) (see paper)
55% identity, 55% coverage: 331:746/754 of query aligns to 6:420/427 of 2gsaB
- active site: V21 (= V346), Y144 (= Y469), E206 (= E531), D239 (= D564), M242 (= M567), K267 (= K592), A401 (= A727)
- binding pyridoxal-5'-phosphate: G117 (= G442), T118 (= T443), Y144 (= Y469), E206 (= E531), N211 (= N536), D239 (= D564), V241 (= V566), M242 (= M567), K267 (= K592)
2gsaA Crystal structure of glutamate-1-semialdehyde aminomutase (aminotransferase, wild-type form) (see paper)
55% identity, 55% coverage: 331:746/754 of query aligns to 6:420/427 of 2gsaA
- active site: V21 (= V346), Y144 (= Y469), E206 (= E531), D239 (= D564), M242 (= M567), K267 (= K592), A401 (= A727)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (= G442), T118 (= T443), Y144 (= Y469), H145 (= H470), G146 (= G471), N211 (= N536), D239 (= D564), V241 (= V566), K267 (= K592)
3usfA Crystal structure of dava-4
55% identity, 55% coverage: 331:746/754 of query aligns to 6:420/427 of 3usfA
- active site: V21 (= V346), Y144 (= Y469), D239 (= D564), M242 (= M567), K267 (= K592), A401 (= A727)
- binding (4s)-4,5-diaminopentanoic acid: S23 (= S348), V25 (= V350), S157 (= S482), K267 (= K592), E400 (= E726)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: G117 (= G442), T118 (= T443), Y144 (= Y469), N211 (= N536), D239 (= D564), V241 (= V566), K267 (= K592)
3fq7A Gabaculine complex of gsam (see paper)
55% identity, 55% coverage: 331:746/754 of query aligns to 6:420/427 of 3fq7A
- active site: V21 (= V346), Y144 (= Y469), D239 (= D564), M242 (= M567), K267 (= K592), A401 (= A727)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: S23 (= S348), V25 (= V350), W61 (= W386), G117 (= G442), T118 (= T443), Y144 (= Y469), H145 (= H470), E206 (= E531), N211 (= N536), D239 (= D564), V241 (= V566), M242 (= M567), K267 (= K592), G298 (= G623), T299 (= T624), E400 (= E726)
2hp2A Inter-subunit signaling in gsam (see paper)
55% identity, 55% coverage: 331:746/754 of query aligns to 6:420/427 of 2hp2A
- active site: V21 (= V346), Y144 (= Y469), D239 (= D564), M242 (= M567), K267 (= K592), A401 (= A727)
- binding (4s)-4,5-diaminopentanoic acid: G298 (= G623), T299 (= T624)
- binding (4r)-5-amino-4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: S23 (= S348), G117 (= G442), T118 (= T443), Y144 (= Y469), H145 (= H470), E206 (= E531), N211 (= N536), D239 (= D564), V241 (= V566), M242 (= M567), K267 (= K592)
- binding pyridoxal-5'-phosphate: G298 (= G623), T299 (= T624)
2hp1A Inter-subunit signaling in gsam (see paper)
55% identity, 55% coverage: 331:746/754 of query aligns to 6:420/427 of 2hp1A
- active site: V21 (= V346), Y144 (= Y469), D239 (= D564), M242 (= M567), K267 (= K592), A401 (= A727)
- binding (4s)-4-amino-5-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: S23 (= S348), V25 (= V350), W61 (= W386), S116 (= S441), G117 (= G442), T118 (= T443), Y144 (= Y469), H145 (= H470), G146 (= G471), E206 (= E531), N211 (= N536), D239 (= D564), V241 (= V566), M242 (= M567), K267 (= K592), E400 (= E726)
2hozA Inter-subunit signaling in gsam (see paper)
55% identity, 55% coverage: 331:746/754 of query aligns to 6:420/427 of 2hozA
- active site: V21 (= V346), Y144 (= Y469), D239 (= D564), M242 (= M567), K267 (= K592), A401 (= A727)
- binding (4s)-4,5-diaminopentanoic acid: E141 (= E466), G156 (= G481), S157 (= S482), P182 (≠ S507), N368 (= N694), E370 (≠ A696), K373 (≠ T699)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (= G442), T118 (= T443), Y144 (= Y469), H145 (= H470), G146 (= G471), E206 (= E531), N211 (= N536), D239 (= D564), G298 (= G623), T299 (= T624)
3fqaA Gabaculien complex of gabaculine resistant gsam version (see paper)
55% identity, 55% coverage: 331:746/754 of query aligns to 5:419/426 of 3fqaA
- active site: V20 (= V346), Y143 (= Y469), D238 (= D564), I241 (≠ M567), K266 (= K592), A400 (= A727)
- binding 3-aminobenzoic acid: S22 (= S348), R25 (= R351), W60 (= W386)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G116 (= G442), T117 (= T443), Y143 (= Y469), E205 (= E531), N210 (= N536), D238 (= D564), V240 (= V566), I241 (≠ M567)
3k28A Crystal structure of a glutamate-1-semialdehyde aminotransferase from bacillus anthracis with bound pyridoxal 5'phosphate
55% identity, 54% coverage: 335:738/754 of query aligns to 11:407/423 of 3k28A
- active site: V22 (= V346), Y145 (= Y469), E202 (= E531), D235 (= D564), M238 (= M567), K263 (= K592), G396 (≠ A727)
- binding calcium ion: I103 (≠ C427), V106 (≠ I430), P107 (= P431), I109 (= I433)
- binding pyridoxal-5'-phosphate: G118 (= G442), T119 (= T443), Y145 (= Y469), H146 (= H470), G147 (= G471), E202 (= E531), D235 (= D564), V237 (= V566), M238 (= M567), K263 (= K592)
2e7uA Crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from thermus thermophilus hb8
54% identity, 56% coverage: 331:750/754 of query aligns to 6:424/424 of 2e7uA
- active site: V21 (= V346), Y144 (= Y469), E206 (= E531), D238 (= D564), M241 (= M567), K266 (= K592), A401 (= A727)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (= G442), T118 (= T443), Y144 (= Y469), H145 (= H470), N211 (= N536), D238 (= D564), V240 (= V566)
3usfB Crystal structure of dava-4
51% identity, 55% coverage: 331:746/754 of query aligns to 6:395/402 of 3usfB
- active site: V21 (= V346), Y144 (= Y469), E181 (= E531), D214 (= D564), M217 (= M567), K242 (= K592), A376 (= A727)
- binding (4s)-4,5-diaminopentanoic acid: G273 (= G623), T274 (= T624)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: G117 (= G442), T118 (= T443), Y144 (= Y469), E181 (= E531), N186 (= N536), D214 (= D564), V216 (= V566), M217 (= M567), K242 (= K592)
2hp1B Inter-subunit signaling in gsam (see paper)
51% identity, 55% coverage: 331:746/754 of query aligns to 6:391/398 of 2hp1B
- active site: V21 (= V346), Y144 (= Y469), E177 (= E531), D210 (= D564), M213 (= M567), K238 (= K592), A372 (= A727)
- binding (4s)-4-amino-5-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: G269 (= G623), T270 (= T624)
- binding (4s)-4,5-diaminopentanoic acid: S23 (= S348), V25 (= V350), R26 (= R351), W61 (= W386), Y144 (= Y469)
- binding pyridoxal-5'-phosphate: S116 (= S441), G117 (= G442), T118 (= T443), Y144 (= Y469), E177 (= E531), N182 (= N536), D210 (= D564), V212 (= V566), M213 (= M567), K238 (= K592)
Query Sequence
>WP_086510216.1 NCBI__GCF_002151265.1:WP_086510216.1
MAGATNVQPPVVLVLAGHDPTGGAGIMADGEAIAACGGWALTVPTALTMQDCRDVHRVVP
VPAELIREMTARLSGFRLAAIKVGLLASRETLDAVVDIIKARPGIPVVVDPVLKAGGGKE
LSTSALVEVFRSRLLPLVDILTPNRLELERLAGTEPQDDEARARRLLALGCRAVLVTGSD
DPSSDVPQDVVEQMLYTSEQSRAWRWPRLAGSFHGSGCTLAAALAARLAAGEPLAAACEQ
AQRFTWQALAKAWQPGNAQALPRRTASQGSWHDPVQGVAKAPSMSEDHRNFTTHSKVIQE
VIHRPGSVSLALPVTGLHHSRDSKEAYMTTSETLFEQARRHIPGGVNSPVRAFKGLHRPP
VFMERAQGAYLFDVEGKRYVDYVGSWGPMITGHADPDVLGAVRSRLDHGLSFGTPTAIET
TMAELICEMIPSIELVRMVNSGTEATMSAIRLARGYTGRDKIVKFEGNYHGHSDSLLVKA
GSGALTHGEPSSPGVPASLAEHTITLSYNDLDEVEACFEEIGSEIACIIVEPVAGNMNCI
PPQPGFLETLRRVCTEYGSVLIFDEVMTGFRVALGGAQAHFGIEPDLTCLGKIVGGGMPV
GAFGGKRAIMEQISPLGPVYQAGTLSGNPLAMAAGIALLTKLREPGFHDALAQRVETLCH
GLQERADAAGVDMITQRVGGMFGLFFTGQTRVDNFAQATACDAEAFRRFFAAMLEEGVYL
APSAYEAGFMSSAHTPEDIQFTLDAAEKAFAKVR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory