SitesBLAST
Comparing WP_086510351.1 NCBI__GCF_002151265.1:WP_086510351.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
35% identity, 96% coverage: 4:306/315 of query aligns to 21:327/339 of Q7XSN8
- E219 (= E201) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ S207) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
36% identity, 95% coverage: 7:306/315 of query aligns to 9:314/322 of 7nbgAAA
- active site: K53 (= K51), S81 (≠ A76), E207 (= E201), A211 (= A205), D213 (≠ S207), G236 (≠ S229), L309 (≠ I301), S310 (≠ T302)
- binding calcium ion: E207 (= E201), A211 (= A205), D213 (≠ S207)
- binding pyridoxal-5'-phosphate: F52 (= F50), K53 (= K51), N83 (= N78), G182 (= G176), G183 (= G177), G184 (= G178), G185 (= G179), M186 (≠ L180), G236 (≠ S229), V237 (≠ L230), T282 (≠ G276), S310 (≠ T302), G311 (= G303)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A76), G85 (≠ A80), Q86 (≠ L81), I101 (= I96), K111 (= K106), I115 (≠ S110), Y118 (≠ L113)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
36% identity, 95% coverage: 7:306/315 of query aligns to 9:314/323 of 7nbfAAA
- active site: K53 (= K51), S81 (≠ A76), E207 (= E201), A211 (= A205), D213 (≠ S207), G236 (≠ S229), L309 (≠ I301), S310 (≠ T302)
- binding calcium ion: E207 (= E201), A211 (= A205), D213 (≠ S207)
- binding magnesium ion: N244 (≠ H238)
- binding pyridoxal-5'-phosphate: F52 (= F50), K53 (= K51), N83 (= N78), G182 (= G176), G183 (= G177), G184 (= G178), G185 (= G179), M186 (≠ L180), G236 (≠ S229), V237 (≠ L230), T282 (≠ G276), S310 (≠ T302), G311 (= G303)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ P19), L22 (≠ P20), T23 (= T21), P24 (= P22), L26 (= L24), T27 (≠ L25), F46 (= F44)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
36% identity, 95% coverage: 7:306/315 of query aligns to 9:314/323 of 7nbdAAA
- active site: K53 (= K51), S81 (≠ A76), E207 (= E201), A211 (= A205), D213 (≠ S207), G236 (≠ S229), L309 (≠ I301), S310 (≠ T302)
- binding calcium ion: E207 (= E201), A211 (= A205), D213 (≠ S207)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ L266), L278 (≠ M272), V314 (≠ M306)
- binding magnesium ion: N244 (≠ H238)
- binding pyridoxal-5'-phosphate: F52 (= F50), K53 (= K51), N83 (= N78), G182 (= G176), G183 (= G177), G184 (= G178), G185 (= G179), M186 (≠ L180), G236 (≠ S229), V237 (≠ L230), E280 (= E274), T282 (≠ G276), S310 (≠ T302), G311 (= G303)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
36% identity, 95% coverage: 7:306/315 of query aligns to 9:314/323 of 7nbcCCC
- active site: K53 (= K51), S81 (≠ A76), E207 (= E201), A211 (= A205), D213 (≠ S207), G236 (≠ S229), L309 (≠ I301), S310 (≠ T302)
- binding biphenyl-4-ylacetic acid: T78 (vs. gap), H79 (vs. gap), H84 (= H79), V148 (= V142), H149 (= H143), P150 (= P144)
- binding calcium ion: E207 (= E201), A211 (= A205), D213 (≠ S207)
- binding pyridoxal-5'-phosphate: F52 (= F50), K53 (= K51), N83 (= N78), G182 (= G176), G183 (= G177), G184 (= G178), G185 (= G179), M186 (≠ L180), G236 (≠ S229), V237 (≠ L230), T282 (≠ G276), S310 (≠ T302), G311 (= G303)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
36% identity, 95% coverage: 7:306/315 of query aligns to 9:314/323 of 7nbcAAA
- active site: K53 (= K51), S81 (≠ A76), E207 (= E201), A211 (= A205), D213 (≠ S207), G236 (≠ S229), L309 (≠ I301), S310 (≠ T302)
- binding calcium ion: E207 (= E201), A211 (= A205), D213 (≠ S207)
- binding magnesium ion: N244 (≠ H238)
- binding pyridoxal-5'-phosphate: F52 (= F50), K53 (= K51), N83 (= N78), G182 (= G176), G183 (= G177), G184 (= G178), G185 (= G179), M186 (≠ L180), G236 (≠ S229), V237 (≠ L230), T282 (≠ G276), S310 (≠ T302), G311 (= G303)
Sites not aligning to the query:
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
36% identity, 95% coverage: 7:306/315 of query aligns to 9:314/320 of 7nbhAAA
- active site: K53 (= K51), S81 (≠ A76), E207 (= E201), A211 (= A205), D213 (≠ S207), G236 (≠ S229), L309 (≠ I301), S310 (≠ T302)
- binding calcium ion: E207 (= E201), A211 (= A205), D213 (≠ S207)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A76), G85 (≠ A80), Q86 (≠ L81), K111 (= K106), I115 (≠ S110), Y118 (≠ L113), D235 (≠ K228), P281 (= P275), N313 (= N305), V314 (≠ M306)
Sites not aligning to the query:
6zspAAA serine racemase bound to atp and malonate. (see paper)
35% identity, 95% coverage: 7:306/315 of query aligns to 9:307/320 of 6zspAAA
- active site: K53 (= K51), S74 (≠ A76), E200 (= E201), A204 (= A205), D206 (≠ S207), G229 (≠ S229), L302 (≠ I301), S303 (≠ T302)
- binding adenosine-5'-triphosphate: S28 (≠ D26), S29 (≠ H27), I30 (≠ V28), K48 (≠ R46), T49 (= T47), Q79 (≠ L81), Y111 (≠ L113), E266 (≠ Y267), R267 (≠ Q268), K269 (= K270), N306 (= N305)
- binding magnesium ion: E200 (= E201), A204 (= A205), D206 (≠ S207)
- binding malonate ion: K53 (= K51), S73 (= S75), S74 (≠ A76), N76 (= N78), H77 (= H79), R125 (≠ W127), G229 (≠ S229), S232 (≠ A232)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
35% identity, 95% coverage: 7:306/315 of query aligns to 9:309/310 of 7nbgDDD
- active site: K53 (= K51), S76 (≠ A76), E202 (= E201), A206 (= A205), D208 (≠ S207), G231 (≠ S229), L304 (≠ I301), S305 (≠ T302)
- binding calcium ion: E202 (= E201), A206 (= A205), D208 (≠ S207)
- binding magnesium ion: N239 (≠ H238)
- binding ortho-xylene: S76 (≠ A76), Q81 (≠ L81), I96 (= I96), Y113 (≠ L113)
- binding pyridoxal-5'-phosphate: F52 (= F50), K53 (= K51), N78 (= N78), G177 (= G176), G178 (= G177), G179 (= G178), G180 (= G179), M181 (≠ L180), G231 (≠ S229), V232 (≠ L230), E275 (= E274), T277 (≠ G276), S305 (≠ T302), G306 (= G303)
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
35% identity, 95% coverage: 7:306/315 of query aligns to 10:310/322 of 3l6bA
- active site: K54 (= K51), S77 (≠ A76), E203 (= E201), A207 (= A205), D209 (≠ S207), G232 (≠ S229), T278 (≠ G276), L305 (≠ I301), S306 (≠ T302)
- binding malonate ion: K54 (= K51), S76 (= S75), S77 (≠ A76), N79 (= N78), H80 (= H79), R128 (≠ W127), G232 (≠ S229)
- binding manganese (ii) ion: E203 (= E201), A207 (= A205), D209 (≠ S207)
- binding pyridoxal-5'-phosphate: F53 (= F50), K54 (= K51), N79 (= N78), G178 (= G176), G179 (= G177), G180 (= G178), G181 (= G179), M182 (≠ L180), V233 (≠ L230), E276 (= E274), T278 (≠ G276), S306 (≠ T302), G307 (= G303)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
36% identity, 94% coverage: 21:315/315 of query aligns to 23:317/319 of A4F2N8
- K53 (= K51) mutation to A: Loss of enzymatic activity.
5cvcA Structure of maize serine racemase (see paper)
35% identity, 96% coverage: 4:306/315 of query aligns to 5:311/329 of 5cvcA
- active site: K52 (= K51), S77 (≠ A76), E203 (= E201), A207 (= A205), D209 (≠ S207), G231 (≠ S229), V306 (≠ I301), S307 (≠ T302)
- binding magnesium ion: E203 (= E201), A207 (= A205), D209 (≠ S207)
- binding pyridoxal-5'-phosphate: F51 (= F50), K52 (= K51), N79 (= N78), S178 (≠ G176), G179 (= G177), G180 (= G178), G181 (= G179), L232 (= L230), E275 (= E274), S307 (≠ T302), G308 (= G303)
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
36% identity, 87% coverage: 2:274/315 of query aligns to 7:280/326 of 2gn2A
- active site: K56 (= K51), A81 (= A76), Q207 (≠ E201), V211 (≠ A205), G213 (≠ S207), G235 (≠ S229)
- binding cytidine-5'-monophosphate: R51 (= R46), T52 (= T47), G53 (= G48), A114 (≠ G109), D117 (≠ K112), Y118 (≠ L113)
Sites not aligning to the query:
3hmkA Crystal structure of serine racemase (see paper)
35% identity, 97% coverage: 7:312/315 of query aligns to 10:321/321 of 3hmkA
- active site: K54 (= K51), S82 (≠ A76), E208 (= E201), A212 (= A205), D214 (≠ S207), G237 (≠ S229), T283 (≠ G276), L310 (≠ I301), S311 (≠ T302)
- binding manganese (ii) ion: E208 (= E201), A212 (= A205), D214 (≠ S207)
- binding pyridoxal-5'-phosphate: F53 (= F50), K54 (= K51), N84 (= N78), G183 (= G176), G184 (= G177), G185 (= G178), G186 (= G179), M187 (≠ L180), G237 (≠ S229), V238 (≠ L230), T283 (≠ G276), S311 (≠ T302), G312 (= G303)
Q9QZX7 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Mus musculus (Mouse) (see paper)
35% identity, 97% coverage: 7:312/315 of query aligns to 12:323/339 of Q9QZX7
- C113 (≠ F105) modified: S-nitrosocysteine; mutation to S: Abolishes S-nitrosylation.
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
35% identity, 91% coverage: 21:307/315 of query aligns to 32:320/514 of P04968
- K62 (= K51) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N78) binding
- GGGGL 188:192 (= GGGGL 176:180) binding
- S315 (≠ T302) binding
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
35% identity, 91% coverage: 21:307/315 of query aligns to 28:316/494 of 1tdjA
- active site: K58 (= K51), A83 (= A76), E209 (= E201), S213 (≠ A205), C215 (≠ S207), G237 (≠ S229), L310 (≠ I301), S311 (≠ T302)
- binding pyridoxal-5'-phosphate: F57 (= F50), K58 (= K51), N85 (= N78), G184 (= G176), G185 (= G177), G186 (= G178), G187 (= G179), G237 (≠ S229), E282 (= E274), S311 (≠ T302), G312 (= G303)
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
41% identity, 96% coverage: 4:305/315 of query aligns to 3:303/308 of 1ve5A
- active site: K50 (= K51), S56 (≠ N57), S72 (≠ A76), E200 (= E201), A204 (= A205), D206 (≠ S207), G229 (≠ S229), L299 (≠ I301), S300 (≠ T302)
- binding calcium ion: E200 (= E201), A204 (= A205), D206 (≠ S207)
- binding pyridoxal-5'-phosphate: F49 (= F50), K50 (= K51), N74 (= N78), G175 (= G176), G176 (= G177), G177 (= G178), G178 (= G179), E274 (= E274), T276 (≠ G276), S300 (≠ T302), G301 (= G303)
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
29% identity, 100% coverage: 1:315/315 of query aligns to 1:316/318 of 1wtcA
- active site: K52 (= K51), S77 (≠ A76), E203 (= E201), G207 (≠ A205), D209 (≠ S207), G231 (≠ S229), I302 (= I301), S303 (≠ T302)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ P19), K47 (≠ R46), M48 (≠ T47), A109 (≠ E108), A110 (≠ G109), Y114 (≠ L113)
- binding magnesium ion: E203 (= E201), G207 (≠ A205), D209 (≠ S207)
- binding pyridoxal-5'-phosphate: F51 (= F50), K52 (= K51), N79 (= N78), G178 (= G176), G179 (= G177), G180 (= G178), G181 (= G179), G231 (≠ S229), E276 (= E274), T278 (≠ G276), S303 (≠ T302)
1v71A Crystal structure of s.Pombe serine racemase
29% identity, 100% coverage: 1:315/315 of query aligns to 1:316/318 of 1v71A
- active site: K52 (= K51), S77 (≠ A76), E203 (= E201), G207 (≠ A205), D209 (≠ S207), G231 (≠ S229), I302 (= I301), S303 (≠ T302)
- binding magnesium ion: E203 (= E201), G207 (≠ A205), D209 (≠ S207)
- binding pyridoxal-5'-phosphate: F51 (= F50), K52 (= K51), N79 (= N78), G178 (= G176), G179 (= G177), G180 (= G178), G181 (= G179), G231 (≠ S229), E276 (= E274), T278 (≠ G276), S303 (≠ T302), G304 (= G303)
Query Sequence
>WP_086510351.1 NCBI__GCF_002151265.1:WP_086510351.1
MLPLERIQEAQRRIADSLPPTPLLLDHVLSEKFGRRIWLKGELFQRTGSFKPRGGLNWLR
SAGEEELAGGLGAVSAGNHALGLAWAAGQADVPVTIVMPENASPFKVEGSRKLGAEVILH
GDINEAWELMHRLVAERGLTLVHPYDDERIMAGQGTVGLEILEQAPEATAILCPVGGGGL
IAGIGSAAAALRPGLALIGVEPSGAASMAAAWSAGAPERLERVATCAKSLGAAIVGEHTY
PVCRETTQKLLQVDDDAIGRAMRHLLYQAKLMAEPGAAVGVAALLEDLVTLPPEGDVVVV
ITGGNMSPEELSDFL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory