Comparing WP_086510419.1 NCBI__GCF_002151265.1:WP_086510419.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D2Z027 O-ureido-L-serine synthase; Cysteine synthase homolog DscD; O-acetylserine sulfhydrylase; EC 2.6.99.3; EC 2.5.1.47 from Streptomyces lavendulae (see paper)
48% identity, 67% coverage: 1:330/490 of query aligns to 1:316/324 of D2Z027
3x43A Crystal structure of o-ureido-l-serine synthase (see paper)
49% identity, 67% coverage: 4:330/490 of query aligns to 3:315/316 of 3x43A
3x44A Crystal structure of o-ureido-l-serine-bound k43a mutant of o-ureido- l-serine synthase (see paper)
48% identity, 67% coverage: 4:330/490 of query aligns to 3:315/321 of 3x44A
P9WP55 O-acetylserine sulfhydrylase; OAS sulfhydrylase; OASS; Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine-specific cysteine synthase; Sulfide-dependent cysteine synthase; EC 2.5.1.47 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
48% identity, 66% coverage: 1:322/490 of query aligns to 1:310/310 of P9WP55
2q3dA 2.2 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) from mycobacterium tuberculosis in complex with the reaction intermediate alpha-aminoacrylate (see paper)
48% identity, 65% coverage: 1:317/490 of query aligns to 1:305/306 of 2q3dA
3zeiA Structure of the mycobacterium tuberculosis o-acetylserine sulfhydrylase (oass) cysk1 in complex with a small molecule inhibitor (see paper)
47% identity, 63% coverage: 1:311/490 of query aligns to 1:299/300 of 3zeiA
2q3cA 2.1 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) holoenzyme from mycobacterium tuberculosis in complex with the inhibitory peptide dfsi (see paper)
47% identity, 63% coverage: 1:311/490 of query aligns to 1:299/300 of 2q3cA
5xoqA Crystal structure of o-acetylserine sulfhydrylase with bound transcription factor peptide inhibitor from planctomyces limnophilus
46% identity, 64% coverage: 9:320/490 of query aligns to 10:309/310 of 5xoqA
3t4pA Crystal structure of o-acetyl serine sulfhydrylase from leishmania donovani in complex with designed tetrapeptide (see paper)
42% identity, 65% coverage: 6:324/490 of query aligns to 13:319/319 of 3t4pA
4lmaA Crystal structure analysis of o-acetylserine sulfhydrylase cysk1 from microcystis aeruginosa 7806 (see paper)
40% identity, 66% coverage: 7:331/490 of query aligns to 7:318/318 of 4lmaA
2efyA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 4-acetylbutyric acid
42% identity, 63% coverage: 11:317/490 of query aligns to 7:301/302 of 2efyA
2ecqA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 3-hydroxylactate
42% identity, 63% coverage: 11:317/490 of query aligns to 7:301/302 of 2ecqA
2ecoA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 4-methylvalerate
42% identity, 63% coverage: 11:317/490 of query aligns to 7:301/302 of 2ecoA
8b9yC Cysteine synthase from trypanosoma cruzi with plp and oas (see paper)
41% identity, 64% coverage: 11:324/490 of query aligns to 18:319/330 of 8b9yC
8b9wA Cysteine synthase from trypanosoma theileri with plp bound (see paper)
40% identity, 64% coverage: 11:324/490 of query aligns to 17:318/329 of 8b9wA
4aecA Crystal structure of the arabidopsis thaliana o-acetyl-serine-(thiol)- lyasE C (see paper)
42% identity, 64% coverage: 11:324/490 of query aligns to 21:323/323 of 4aecA
6kr5B Crystal structure of o-acetyl serine sulfhydrylase isoform 3 from entamoeba histolytica (see paper)
38% identity, 67% coverage: 4:329/490 of query aligns to 12:329/336 of 6kr5B
4lmbA Crystal structure analysis of o-acetylserine sulfhydrylase cysk2 complexed with cystine from microcystis aeruginosa 7806 (see paper)
41% identity, 64% coverage: 7:318/490 of query aligns to 7:309/310 of 4lmbA
P0ABK5 Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine sulfhydrylase A; S-carboxymethylcysteine synthase; Sulfate starvation-induced protein 5; SSI5; EC 2.5.1.47; EC 4.5.1.5 from Escherichia coli (strain K12) (see 5 papers)
41% identity, 65% coverage: 10:329/490 of query aligns to 11:321/323 of P0ABK5
Sites not aligning to the query:
P0A1E3 Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine sulfhydrylase A; EC 2.5.1.47 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
41% identity, 65% coverage: 10:329/490 of query aligns to 11:321/323 of P0A1E3
Sites not aligning to the query:
>WP_086510419.1 NCBI__GCF_002151265.1:WP_086510419.1
MTRYASILDTIGRTPLVRLARLAPPTVNVHVKVEAFNPMGSVKDRMALAVIEAAERSGDL
RPGQTVIEATSGNTGIGLAMVCARKGYPLVVTMAESFSLERRRLLRFLGARVVLTPAAEK
GSGMLAKAIELAERHGYFLCRQFENEANAEVHSRTTAREILDDMQGEPIHAWVSGFGTGG
TLKGVSRVLKAADPRIRIVVAEPDNAPLLGSGEVQPAGVSHPRFRPHLMQGWSPDFISPL
TQQAVAADMVDDVVPVAGDEALRLARELARKEGIFVGISAGATLAAALEVARRAPAGSHI
VCMLPDTGERYQSTPLFEGIEDEMNEEELALSRSTPGCRFDVPAPRPATVQPVATAYDVE
AERCLEACLAQAPVVMFSLAWCEFCWAARKLFARLGVDYLSVDLDSPAYQTDDMGVRLRP
VLARRCGAPTIPQIFIGGEPLGGCSELFEAWHDGSLGRRLAACGVAFDAEAIIDTGLLLP
AWLHPRSATA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory