SitesBLAST
Comparing WP_086510509.1 NCBI__GCF_002151265.1:WP_086510509.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lkyA Crystal structure of isocitrate dehydrogenase from methylococcus capsulatus
38% identity, 91% coverage: 8:339/363 of query aligns to 4:318/339 of 6lkyA
- active site: Y123 (≠ Q134), K174 (= K187), D207 (= D220), D231 (= D244)
- binding nicotinamide-adenine-dinucleotide: P68 (≠ F72), L69 (≠ I73), T71 (≠ G75), N81 (≠ H92), H263 (= H277), G264 (= G278), S265 (= S279), A266 (= A280), D268 (= D282), I269 (= I283), N276 (= N290)
4yb4A Crystal structure of homoisocitrate dehydrogenase from thermus thermophilus in complex with homoisocitrate, magnesium ion (ii) and nadh
38% identity, 96% coverage: 10:358/363 of query aligns to 6:332/333 of 4yb4A
- active site: Y124 (≠ Q134), K170 (= K187), D203 (= D220), D227 (= D244), D231 (= D248)
- binding (1R,2S)-1-hydroxybutane-1,2,4-tricarboxylic acid: S71 (≠ H79), R84 (≠ N90), R87 (= R96), R97 (= R106), R117 (= R127), Y124 (≠ Q134), D227 (= D244)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I12 (= I16), A69 (≠ I77), T70 (≠ G78), S71 (≠ H79), I201 (= I218), N204 (≠ T221), L240 (= L257), E256 (≠ Q274), H259 (= H277), G260 (= G278), S261 (= S279), A262 (= A280), D264 (= D282), I265 (= I283), N272 (= N290), D312 (= D338)
3asjB Crystal structure of homoisocitrate dehydrogenase in complex with a designed inhibitor (see paper)
38% identity, 96% coverage: 10:358/363 of query aligns to 6:332/333 of 3asjB
- active site: Y124 (≠ Q134), K170 (= K187), D203 (= D220), D227 (= D244), D231 (= D248)
- binding (2Z)-3-[(carboxymethyl)sulfanyl]-2-hydroxyprop-2-enoic acid: R84 (≠ N90), R97 (= R106), R117 (= R127), Y124 (≠ Q134), D227 (= D244), D231 (= D248), V258 (≠ T276)
3asjA Crystal structure of homoisocitrate dehydrogenase in complex with a designed inhibitor (see paper)
38% identity, 96% coverage: 10:358/363 of query aligns to 6:332/333 of 3asjA
Q72IW9 Isocitrate/homoisocitrate dehydrogenase; Homoisocitrate dehydrogenase; HICDH; EC 1.1.1.286 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 4 papers)
38% identity, 96% coverage: 10:358/363 of query aligns to 7:333/334 of Q72IW9
- E57 (= E64) mutation to V: Confers enzyme activity with 3-isopropylmalate; when associated with I-72; M-85; A-86; T-208; Y-217; M-238 and M-310.
- ATS 70:72 (≠ IGH 77:79) binding
- S72 (≠ H79) binding in other chain; mutation to I: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; M-85; A-86; T-208; Y-217; M-238 and M-310.
- R85 (≠ N90) binding in other chain; mutation to M: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; A-86; T-208; Y-217; M-238 and M-310.; mutation to V: Confers low enzyme activity with 3-isopropylmalate. Reduces activity with homoisocitrate. Abolishes activity with isocitrate.
- Y86 (≠ I94) mutation to A: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; T-208; Y-217; M-238 and M-310.
- R88 (= R96) binding in other chain
- R98 (= R106) binding in other chain
- R118 (= R127) binding in other chain
- Y125 (≠ Q134) binding in other chain; mutation to A: Reduces catalytic efficiency with isocitrate.
- V135 (= V152) mutation to M: Formation of homodimers instead of homotetramers. Increased affinity for isocitrate. Reduces enzyme activity with isocitrate.
- K171 (= K187) binding
- N173 (≠ T189) binding ; binding
- D204 (= D220) binding
- M208 (= M224) mutation to T: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; Y-217; M-238 and M-310.
- F217 (≠ Y233) mutation to Y: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; M-238 and M-310.
- D228 (= D244) binding
- D232 (= D248) binding
- V238 (= V254) mutation to M: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; Y-217; and M-310.
- GSAPD 261:265 (= GSAPD 278:282) binding
- N273 (= N290) binding
- R310 (= R335) mutation to M: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; Y-217; and M-238.
6m3sB Dimeric isocitrate dehydrogenase from xanthomonas campestris pv. Campestris 8004
37% identity, 94% coverage: 1:343/363 of query aligns to 4:325/338 of 6m3sB
- active site: Y128 (≠ F133), K177 (= K187), D210 (= D220), D234 (= D244)
- binding isocitrate calcium complex: T75 (≠ Y82), S83 (≠ N90), N85 (≠ H92), R89 (= R96), R99 (= R106), R121 (= R127), Y128 (≠ F133), D234 (= D244), D238 (= D248)
- binding nicotinamide-adenine-dinucleotide: P72 (= P76), L73 (≠ I77), T75 (≠ Y82), N85 (≠ H92), H266 (= H277), G267 (= G278), S268 (= S279), A269 (= A280), D271 (= D282), I272 (= I283), N279 (= N290)
3ty3A Crystal structure of homoisocitrate dehydrogenase from schizosaccharomyces pombe bound to glycyl-glycyl-glycine (see paper)
34% identity, 97% coverage: 6:356/363 of query aligns to 3:356/358 of 3ty3A
- active site: Y129 (vs. gap), K192 (= K187), D228 (= D220), D252 (= D244), D256 (= D248)
- binding glycylglycylglycine: A74 (≠ P76), V75 (≠ I77), S77 (≠ H79), R93 (= R96), E281 (≠ Q274), P282 (≠ A275), H284 (= H277)
P40495 Homoisocitrate dehydrogenase, mitochondrial; HIcDH; EC 1.1.1.87 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
35% identity, 97% coverage: 3:354/363 of query aligns to 21:369/371 of P40495
- Y150 (vs. gap) mutation to F: Strongly reduced enzyme activity.
- K206 (= K187) mutation to M: Strongly reduced enzyme activity.
O14104 Homoisocitrate dehydrogenase; HICDH; EC 1.1.1.87 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 97% coverage: 6:356/363 of query aligns to 7:360/362 of O14104
- S81 (≠ H79) modified: Phosphoserine
- S91 (≠ N90) modified: Phosphoserine
4y1pB Crystal structure of 3-isopropylmalate dehydrogenase (saci_0600) from sulfolobus acidocaldarius complex with 3-isopropylmalate and mg2+ (see paper)
32% identity, 97% coverage: 6:356/363 of query aligns to 2:335/336 of 4y1pB
4xxvA Crystal structure of 3-isopropylmalate dehydrogenase from burkholderia thailandensis in complex with NAD
36% identity, 84% coverage: 5:310/363 of query aligns to 1:313/356 of 4xxvA
4iwhA Crystal structure of a 3-isopropylmalate dehydrogenase from burkholderia pseudomallei
36% identity, 84% coverage: 5:310/363 of query aligns to 3:315/358 of 4iwhA
Q9D6R2 Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial; Isocitric dehydrogenase subunit alpha; NAD(+)-specific ICDH subunit alpha; EC 1.1.1.41 from Mus musculus (Mouse) (see paper)
31% identity, 97% coverage: 7:357/363 of query aligns to 33:363/366 of Q9D6R2
- E229 (= E216) mutation to K: Homozygous mutant mice exhibit retinal degeneration.
8grdA Crystal structure of a constitutively active mutant of the alpha beta heterodimer of human idh3 in complex with adp and mg (see paper)
32% identity, 97% coverage: 7:357/363 of query aligns to 3:324/325 of 8grdA
6kdeA Crystal structure of the alpha beta heterodimer of human idh3 in complex with ca(2+) (see paper)
31% identity, 97% coverage: 7:357/363 of query aligns to 4:334/336 of 6kdeA
6kdyA Crystal structure of the alpha bata heterodimer of human idh3 in complex with NAD. (see paper)
31% identity, 97% coverage: 7:357/363 of query aligns to 4:334/335 of 6kdyA
- active site: Y124 (≠ F146), K171 (= K187), D204 (= D220), D228 (= D244)
- binding nicotinamide-adenine-dinucleotide: P69 (= P76), L70 (≠ I77), T72 (≠ Y82), N82 (≠ H92), H261 (= H277), G262 (= G278), T263 (≠ S279), A264 (= A280), D266 (= D282), I267 (= I283), N274 (= N290), D315 (= D338)
P50213 Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial; Isocitric dehydrogenase subunit alpha; NAD(+)-specific ICDH subunit alpha; EC 1.1.1.41 from Homo sapiens (Human) (see 5 papers)
31% identity, 97% coverage: 7:357/363 of query aligns to 33:363/366 of P50213
- R115 (= R96) binding
- A122 (= A103) to T: in RP90; uncertain significance; dbSNP:rs756333430
- R125 (= R106) binding
- R146 (= R127) binding
- E152 (= E145) mutation to A: No significant effect on the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate and ADP.
- Y153 (≠ F146) Critical for catalysis; mutation to F: Complete loss of activity of the heterotetramer, heterodimer composed of IDH3A and IDH3B subunits and the heterodimer composed of IDH3A and IDH3G subunits with no effect on their oligomeric states.
- K169 (≠ R157) mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate and ADP.
- A175 (≠ G163) to V: in RP90; uncertain significance; dbSNP:rs765473830
- K200 (= K187) Critical for catalysis; mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate.
- N202 (≠ T189) mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate.
- M204 (≠ Y191) to I: in RP90; uncertain significance
- D208 (≠ C195) mutation to A: Complete loss of the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate and ADP.
- D233 (= D220) binding
- M239 (≠ L226) to T: in RP90; uncertain significance; dbSNP:rs2074707744
- Y255 (≠ F242) mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate and ADP.
- D257 (= D244) binding
- D261 (= D248) binding
- P304 (= P291) to H: in RP90; uncertain significance; dbSNP:rs756712426
- M313 (= M300) to T: in RP90; uncertain significance; dbSNP:rs149862950
- R316 (≠ E303) to C: in RP90; uncertain significance; dbSNP:rs770798851
5greA Crystal structure of the alpha gamma heterodimer of human idh3 in complex with mg(2+), citrate and adp (see paper)
31% identity, 97% coverage: 7:357/363 of query aligns to 3:323/325 of 5greA
6l59A Crystal structure of the alpha gamma heterodimer of human idh3 in complex with cit, mg and atp binding at allosteric site and mg, atp binding at active site. (see paper)
31% identity, 97% coverage: 7:357/363 of query aligns to 3:322/325 of 6l59A
- active site: Y112 (≠ F146), K159 (= K187), D192 (= D220), D216 (= D244)
- binding adenosine-5'-triphosphate: I12 (= I16), H249 (= H277), G250 (= G278), T251 (≠ S279), A252 (= A280), N262 (= N290), D303 (= D338)
- binding magnesium ion: D216 (= D244), D220 (= D248)
5yvtA Crystal structure of the alpha gamma heterodimer of human idh3 in complex with mg(2+) and nadh (see paper)
31% identity, 97% coverage: 7:357/363 of query aligns to 3:331/332 of 5yvtA
- active site: Y121 (≠ F146), K168 (= K187), D201 (= D220), D225 (= D244), D229 (= D248)
- binding magnesium ion: D225 (= D244), D229 (= D248)
- binding 1,4-dihydronicotinamide adenine dinucleotide: L69 (≠ I77), T71 (≠ Y82), N79 (= N90), N170 (≠ T189), D201 (= D220), E255 (≠ Q274), V257 (≠ T276), H258 (= H277), G259 (= G278), I264 (= I283), N271 (= N290), D312 (= D338)
Query Sequence
>WP_086510509.1 NCBI__GCF_002151265.1:WP_086510509.1
MTQAHLTLGVLNGDDIGHEIVPAAVEVAQAAAERCGLVIDWRHMPLGRKALDEFGTTMPD
GTLETLSTFDGFILGPIGHREYPKVEGAINPHPILRKHFDLFANVRPTRSYPDIGCIYDD
IDLVIVRENNEGFQPDRNVVAGSGEFRPTEDVTISVRVITREGSRKVATAALELARARNK
RLTVVHKNTVYKLGCGMFVEECYKAAEAYPDVKVDEAIVDTFAMHLIRNPQQYDVVVTTN
MFGDILTDEAAGLVGGLGMAPGLCIGRGNMAMAQATHGSAPDIAGTGLANPYAMIESTRM
LIEWLGRRHELPGAQAAAALMAKGIQAALADPRTRTPDIRGQGRLSDMVNGMLAAIKQEM
THA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory