Comparing WP_086510644.1 NCBI__GCF_002151265.1:WP_086510644.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
4v15A Crystal structure of d-threonine aldolase from alcaligenes xylosoxidans (see paper)
28% identity, 84% coverage: 24:370/414 of query aligns to 15:332/373 of 4v15A
Sites not aligning to the query:
A1B8Z1 3-hydroxy-D-aspartate aldolase; beta-hydroxyaspartate aldolase; EC 4.1.3.41 from Paracoccus denitrificans (strain Pd 1222) (see paper)
25% identity, 76% coverage: 1:314/414 of query aligns to 1:305/387 of A1B8Z1
Sites not aligning to the query:
6qkbA Crystal structure of the beta-hydroxyaspartate aldolase of paracoccus denitrificans (see paper)
26% identity, 70% coverage: 25:314/414 of query aligns to 22:302/384 of 6qkbA
Sites not aligning to the query:
7yqaB Crystal structure of d-threonine aldolase from chlamydomonas reinhardtii (see paper)
30% identity, 71% coverage: 34:327/414 of query aligns to 21:311/398 of 7yqaB
Sites not aligning to the query:
B2DFG5 D-threo-3-hydroxyaspartate dehydratase; D-THA DH; D-THA dehydratase; Threo-3-hydroxy-D-aspartate ammonia-lyase; EC 4.3.1.27 from Delftia sp. (strain HT23) (see paper)
30% identity, 58% coverage: 30:268/414 of query aligns to 11:242/380 of B2DFG5
4pb5A D-threo-3-hydroxyaspartate dehydratase h351a mutant complexed with l- erythro-3-hydroxyaspartate (see paper)
30% identity, 58% coverage: 30:268/414 of query aligns to 10:241/379 of 4pb5A
Sites not aligning to the query:
4pb4A D-threo-3-hydroxyaspartate dehydratase h351a mutant complexed with 2- amino maleic acid (see paper)
30% identity, 58% coverage: 30:268/414 of query aligns to 10:241/379 of 4pb4A
3wqeA D-threo-3-hydroxyaspartate dehydratase from delftia sp. Ht23 complexed with d-allothreonine (see paper)
30% identity, 58% coverage: 30:268/414 of query aligns to 10:241/379 of 3wqeA
Sites not aligning to the query:
3wqdA D-threo-3-hydroxyaspartate dehydratase from delftia sp. Ht23 complexed with d-erythro-3-hydroxyaspartate (see paper)
30% identity, 58% coverage: 30:268/414 of query aligns to 10:241/379 of 3wqdA
Sites not aligning to the query:
3wqcA D-threo-3-hydroxyaspartate dehydratase from delftia sp. Ht23 (see paper)
30% identity, 58% coverage: 30:268/414 of query aligns to 10:241/379 of 3wqcA
Sites not aligning to the query:
4pb3B D-threo-3-hydroxyaspartate dehydratase h351a mutant (see paper)
30% identity, 58% coverage: 30:268/414 of query aligns to 20:251/389 of 4pb3B
3anvA Crystal structure of d-serine dehydratase from chicken kidney (2,3-dap complex) (see paper)
25% identity, 60% coverage: 22:268/414 of query aligns to 4:246/373 of 3anvA
Sites not aligning to the query:
A0A8V1ABE9 D-serine dehydratase; EC 4.3.1.18 from Gallus gallus (Chicken) (see paper)
25% identity, 60% coverage: 22:268/414 of query aligns to 5:247/376 of A0A8V1ABE9
Sites not aligning to the query:
>WP_086510644.1 NCBI__GCF_002151265.1:WP_086510644.1
MNGKEAAAGGDQHKGMPEVGISLLSGVSLPAAVIHEPALAHNLAWMQRFCEDHGARLAPH
GKTTMCPELFQRQLAAGAWGITLATAPQCRAAFRHGINRLLMANQLVGEANMAIVAELIE
AGADFYCVVDSVANADQLARYFTARGLRLQVLIELGVPGGRCGCRDTDDVMALAERIDSE
QALVLCGLEGYEGVVHGNEPERAVRAYAWQLVEAAQALDKDALIESPQPLITASGSAWYD
MIAEVFREAHLGKQFVPVLRPGCYVVHDHGIYRQAQHDILGRRPELERGLKPALEVFAQV
LSLPEPGLAIVGMGKRDIGHDQLPEPLRRYREGDERPGRTLSVAGWRVTKLMDQHAFVHL
PQDEDEPEVGNGRVQVGDIVAFGVSHPCLTFDKWRRVCRVDERLEVVEVMQTLF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory