Comparing WP_086510679.1 NCBI__GCF_002151265.1:WP_086510679.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5hwnB Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate (see paper)
51% identity, 97% coverage: 8:304/305 of query aligns to 6:301/310 of 5hwnB
4ur8A Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid (see paper)
51% identity, 97% coverage: 8:304/305 of query aligns to 6:301/304 of 4ur8A
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
29% identity, 90% coverage: 16:291/305 of query aligns to 12:282/297 of 5j5dA
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 90% coverage: 16:291/305 of query aligns to 15:285/300 of P9WP25
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
29% identity, 90% coverage: 16:291/305 of query aligns to 11:281/296 of 1xxxA
3l21B The crystal structure of a dimeric mutant of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis - dhdps- a204r
29% identity, 90% coverage: 16:291/305 of query aligns to 10:280/295 of 3l21B
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
32% identity, 58% coverage: 21:198/305 of query aligns to 10:191/291 of 4dxvA
Sites not aligning to the query:
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
32% identity, 58% coverage: 21:198/305 of query aligns to 10:191/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
32% identity, 58% coverage: 21:198/305 of query aligns to 10:191/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
32% identity, 58% coverage: 21:198/305 of query aligns to 10:191/291 of 3tceA
Sites not aligning to the query:
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
32% identity, 58% coverage: 21:198/305 of query aligns to 10:191/291 of 3rk8A
Sites not aligning to the query:
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
32% identity, 58% coverage: 21:198/305 of query aligns to 10:191/291 of 3pueB
Sites not aligning to the query:
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
36% identity, 58% coverage: 21:198/305 of query aligns to 10:191/292 of 3s8hA
Sites not aligning to the query:
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
36% identity, 58% coverage: 21:198/305 of query aligns to 10:191/292 of 3puoA
Sites not aligning to the query:
7kkdB Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84a mutant with pyruvate bound in the active site and r,r-bislysine bound at the allosteric site
29% identity, 93% coverage: 15:299/305 of query aligns to 16:298/306 of 7kkdB
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
27% identity, 93% coverage: 14:296/305 of query aligns to 3:282/292 of Q07607
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
29% identity, 93% coverage: 15:299/305 of query aligns to 6:288/296 of 4m19A
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
30% identity, 71% coverage: 21:238/305 of query aligns to 11:231/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
30% identity, 71% coverage: 21:238/305 of query aligns to 10:230/294 of Q9X1K9
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
29% identity, 93% coverage: 15:299/305 of query aligns to 6:288/296 of 6u01B
>WP_086510679.1 NCBI__GCF_002151265.1:WP_086510679.1
MKFSRAAVMEALGDGLLSFPITDFDKEGRFDADSYRRRLEWFISHDISAVFVAGGTGEFF
NLSLDEYRDVVRVAVETVAGRLPVIASSGLSVASGRAFAKAAEAAGADGILLMPPYLTEC
PQEGLVEYARAICDSTELNVIYYNRGNGVLDAGSVRALAASCPNLIGLKDGKGDIQALNK
IIKTIGDRLVYVGGVPTAEIFAEAYLAIGVNTYSSAVFNFVPDMAVKFYRELRAGNAEVV
KRITSDFFIPFVDLRDRKPGYAVSLIKAGAEIIGRPAGSVRAPLVMPTPEERSRLEKLVG
IAQQL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory