SitesBLAST
Comparing WP_086510728.1 NCBI__GCF_002151265.1:WP_086510728.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
66% identity, 99% coverage: 1:719/725 of query aligns to 1:714/715 of 1wdlA
- active site: A69 (= A73), N89 (≠ L93), N93 (≠ H97), G117 (= G121), E120 (= E124), P139 (= P143), E140 (= E144), P147 (= P151), G148 (= G152), S430 (= S434), H451 (= H455), E463 (= E467), N501 (= N505)
- binding nicotinamide-adenine-dinucleotide: A322 (= A326), I324 (= I328), M325 (= M329), D344 (= D348), I345 (= I349), A400 (= A404), V401 (= V405), E403 (= E407), N428 (= N432), T429 (= T433), S430 (= S434)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
66% identity, 99% coverage: 1:719/725 of query aligns to 1:714/715 of P28793
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
65% identity, 99% coverage: 1:719/725 of query aligns to 1:706/707 of 1wdmA
- active site: A69 (= A73), N89 (≠ L93), N93 (≠ H97), G117 (= G121), E120 (= E124), P139 (= P143), E140 (= E144), P147 (= P151), G148 (= G152), S430 (= S434), H451 (= H455), E463 (= E467), N501 (= N505)
- binding acetyl coenzyme *a: K142 (= K146), D297 (= D301), M459 (= M463), N501 (= N505), P534 (= P538), Y652 (= Y664), L658 (≠ P670)
- binding nicotinamide-adenine-dinucleotide: G321 (= G325), A322 (= A326), I324 (= I328), M325 (= M329), D344 (= D348), V401 (= V405), E403 (= E407), N428 (= N432), S430 (= S434), N454 (= N458)
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
55% identity, 99% coverage: 1:720/725 of query aligns to 1:715/729 of P21177
- G116 (= G121) mutation to F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
- G322 (= G327) mutation to A: 10-fold increase in KM for NADH.
- H450 (= H455) active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
55% identity, 99% coverage: 1:720/725 of query aligns to 1:715/719 of 6tnmA
- active site: A68 (= A73), F73 (= F78), G116 (= G121), E119 (= E124), P138 (= P143), E139 (= E144), G147 (= G152), N271 (≠ A276), S429 (= S434), H450 (= H455), E462 (= E467), N500 (= N505)
- binding adenosine-5'-triphosphate: D343 (= D348), I344 (= I349), V400 (= V405), V401 (= V406), V406 (= V411), K584 (= K588)
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
36% identity, 97% coverage: 19:723/725 of query aligns to 11:707/707 of 6yswA
- active site: A66 (= A73), I71 (≠ F82), A84 (≠ L93), Q88 (≠ H97), G112 (= G121), E115 (= E124), P136 (= P143), E137 (= E144), G145 (= G152), D264 (≠ A276), S422 (= S434), H443 (= H455), E455 (= E467), N493 (= N505)
- binding coenzyme a: E23 (= E31), M25 (≠ I33), A66 (= A73), D67 (= D74), I68 (= I75), P136 (= P143), E137 (= E144), L140 (= L147), T290 (≠ Q302), K293 (= K305)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
33% identity, 99% coverage: 3:719/725 of query aligns to 29:762/763 of P40939
- V282 (≠ G243) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (= I260) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (= L297) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E467) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
32% identity, 97% coverage: 19:718/725 of query aligns to 8:690/692 of 6iunB
- active site: A60 (= A73), F65 (= F78), E73 (= E90), H77 (= H97), G101 (= G121), E104 (= E124), E124 (= E144), G132 (= G152), K248 (vs. gap), S407 (= S434), H428 (= H455), E440 (= E467), N478 (= N505)
- binding nicotinamide-adenine-dinucleotide: G300 (= G327), T301 (≠ I328), M302 (= M329), E321 (≠ D348), T322 (≠ I349), Y365 (= Y392), A377 (= A404), V378 (= V405), E380 (= E407), V384 (= V411), V388 (= V415), N405 (= N432), S407 (= S434)
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
34% identity, 95% coverage: 19:708/725 of query aligns to 11:709/711 of 7o4uA
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
34% identity, 95% coverage: 19:708/725 of query aligns to 21:726/728 of 8oqlA
- binding Hexafluorophosphate anion: V37 (≠ K35), N39 (≠ S37), G75 (= G72), D77 (= D74), M81 (= M81), V92 (≠ M92), T95 (≠ K95), P148 (= P143), E149 (= E144), L152 (= L147), Q180 (≠ G174), Q260 (≠ G247), K362 (= K347), D363 (= D348), V364 (≠ I349), V430 (= V415), D476 (≠ H461), K477 (≠ R462), M478 (= M463), P479 (= P464), K506 (= K491)
- binding formamide: V78 (≠ I75), K79 (≠ Q79)
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
34% identity, 95% coverage: 19:708/725 of query aligns to 24:729/731 of 4b3iA
- active site: G79 (≠ A73), E100 (≠ H97), R104 (vs. gap), G127 (= G121), E130 (= E124), P151 (= P143), E152 (= E144), G160 (= G152), S452 (= S434), H473 (= H455), E485 (= E467), S523 (≠ N505)
- binding adenosine-5'-diphosphate: Q640 (≠ E625), P641 (≠ F626), P642 (≠ S627), L643 (≠ D628), Q644 (≠ E629)
- binding coenzyme a: T38 (≠ I33), V40 (≠ K35), A77 (≠ V71), G79 (≠ A73), D80 (= D74), V81 (≠ I75), E152 (= E144), F315 (≠ M299), Q319 (= Q302)
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
34% identity, 95% coverage: 19:708/725 of query aligns to 21:726/727 of 8oqoA
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
34% identity, 95% coverage: 19:708/725 of query aligns to 22:727/728 of 8oqrA
- binding 4-cyanobenzenesulfonic acid: G76 (= G72), G77 (≠ A73), T81 (= T80), M82 (= M81), M82 (= M81), A85 (≠ K84), D89 (≠ F88), T96 (≠ K95), L123 (= L119), G124 (= G120), P149 (= P143), E150 (= E144), S366 (≠ K350), L367 (≠ E351), E368 (= E352), A420 (= A404), V421 (= V405), F422 (≠ V406)
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
34% identity, 95% coverage: 19:708/725 of query aligns to 22:727/729 of 8pf8A
- binding [2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boronic acid: G76 (= G72), F169 (≠ I163), N173 (= N167), S177 (≠ E170), I193 (≠ V186), F313 (≠ M299)
- binding bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]-bis(oxidanyl)boranuide: M39 (≠ L36), N40 (≠ S37), E41 (≠ S38), T81 (= T80), D92 (≠ S91), V93 (≠ M92)
- binding [(2~{R})-2,3-bis(oxidanyl)propoxy]-[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]borinic acid: M39 (≠ L36), G77 (≠ A73), D78 (= D74), M82 (= M81), V93 (≠ M92)
- binding (2~{R})-3-bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boranyloxypropane-1,2-diol: T152 (≠ K146), R184 (≠ E177), A311 (≠ L297), F312 (= F298), I673 (≠ M660)
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
34% identity, 95% coverage: 19:708/725 of query aligns to 23:728/730 of 8oquA
- binding 4-chloranylbenzenesulfonic acid: M40 (≠ L36), N41 (≠ S37), E42 (≠ S38), G77 (= G72), G78 (≠ A73), D79 (= D74), V80 (≠ I75), D90 (≠ F88), V94 (≠ M92), L124 (= L119), G125 (= G120), P150 (= P143), E151 (= E144)
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
34% identity, 95% coverage: 19:708/725 of query aligns to 22:727/729 of 8oqtA
- binding 4-bromanylbenzenesulfonic acid: E41 (≠ S38), G76 (= G72), G77 (≠ A73), D78 (= D74), V79 (≠ I75), M82 (= M81), D89 (≠ F88), V93 (≠ M92), T96 (≠ K95), T96 (≠ K95), P149 (= P143), E150 (= E144)
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
34% identity, 95% coverage: 19:708/725 of query aligns to 22:727/729 of 8oqnA
- binding 1-benzyl-1H-pyrazole-4-carboxylic acid: M39 (≠ L36), M82 (= M81), E150 (= E144), Q172 (≠ D166), F175 (vs. gap), V176 (= V169), Q181 (≠ G174), T241 (vs. gap), F254 (= F238), N257 (≠ G243), Q261 (≠ G247), L262 (≠ K248), P266 (≠ H252), P268 (= P254), Q282 (≠ G268), V283 (≠ E269), G302 (≠ T288), Q303 (≠ D289), V304 (= V290), S521 (≠ N505), G525 (≠ F509)
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
34% identity, 95% coverage: 19:708/725 of query aligns to 22:727/729 of 8opvA
- binding resveratrol: M39 (≠ L36), A75 (≠ V71), G76 (= G72), M82 (= M81), E128 (= E124), P149 (= P143), E150 (= E144), T152 (≠ K146), L153 (= L147), R184 (≠ E177), F296 (= F282)
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
34% identity, 95% coverage: 19:708/725 of query aligns to 22:727/729 of 8opuA
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
34% identity, 95% coverage: 19:708/725 of query aligns to 16:721/723 of 8oqqA
Query Sequence
>WP_086510728.1 NCBI__GCF_002151265.1:WP_086510728.1
MIYQGNAITVARGTKNGGDDVAMLTFDLKDESINKLSSAVIAELDEAVQAIRAESGLKGL
VIGSAKESFIVGADITEFQTMFGKGAEFLESMLMKVHDIFNAIEDLPFPTVTAINGLALG
GGCEVTLTTDFRVMGDKAKIGLPETKLGILPGWGGCVRLPRMIGSDNAVEWIAGGTENRA
DAALKVGAVDAVVPNDQLEAAALDILARANAGELDYQARRAEKTGPLKLNAIEQMMAFET
AKGYVAGKAGPHYPAPIEAIKAIQKGAGEERARAQAIEAKAFAKLAMTDVAFNLVGLFMN
DQVVKKKAGKFEKQAKAVNQTAVLGAGIMGGGIAYQSASKGTPILMKDIKEEAVELGLKE
SRKLFAKQVERGKLTTEQMAEKLTLIRPTLSYGDFGHVDLVVEAVVENPKVKDAVLTEVE
GLVSEDTILTSNTSTISITRLAQNLKRPENFCGMHFFNPVHRMPLVEVIRGEKTGDAAVA
ATVAYARAMGKTPIVVNDCPGFLVNRVLFPYFGGFSLLVEQGADFQRVDKVMEKFGWPMG
PAYLLDVVGMDTAVHANEVMAEGFPERMARDGKTAIQVMYENERLGQKNDKGFYAYEEDK
KGKPKKVSDDKAYELVKQVVVSEKEFSDEEIIARMMVPLCLETVRCLEDDIVETPAEADM
ALIYGIGFPPFRGGALRYIDAMGVAEFVKLADGLAEELGPLYAPTDKLRKMAESGERFYP
SQAQG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory