SitesBLAST
Comparing WP_086510738.1 NCBI__GCF_002151265.1:WP_086510738.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q58761 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
33% identity, 93% coverage: 15:290/297 of query aligns to 13:284/284 of Q58761
1u9zA Crystal structure of phosphoribosyl diphosphate synthase complexed with amp and ribose 5-phosphate (see paper)
33% identity, 92% coverage: 15:286/297 of query aligns to 13:270/274 of 1u9zA
- binding adenosine monophosphate: F32 (= F34), D34 (= D36), E36 (= E38), R92 (= R94), Q93 (= Q95), F97 (= F99), H125 (= H127)
- binding ribose-5-phosphate: D163 (= D169), D202 (= D218), I205 (≠ A221), S206 (= S222), T207 (≠ S223), G208 (= G224), T210 (= T226)
Q97Z86 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 87% coverage: 16:273/297 of query aligns to 14:271/291 of Q97Z86
4twbA Sulfolobus solfataricus ribose-phosphate pyrophosphokinase (see paper)
29% identity, 87% coverage: 16:273/297 of query aligns to 14:258/278 of 4twbA
8dbkB Human prps1 with phosphate, atp, and r5p; hexamer with resolved catalytic loops (see paper)
28% identity, 88% coverage: 15:276/297 of query aligns to 15:277/316 of 8dbkB
- binding adenosine monophosphate: R95 (= R94), Q96 (= Q95), N199 (≠ R198)
- binding adenosine-5'-triphosphate: F34 (= F34), N36 (≠ D36), E38 (= E38)
- binding phosphate ion: S46 (≠ A46), R48 (≠ L48)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: H129 (= H127), D170 (= D169), G172 (≠ E171), K193 (= K192), R195 (= R194), D219 (= D218), D220 (= D219), D223 (≠ S222), T224 (≠ S223), C225 (≠ G224), G226 (≠ R225), T227 (= T226)
8dbeA Human prps1 with adp; hexamer (see paper)
28% identity, 88% coverage: 15:276/297 of query aligns to 15:277/316 of 8dbeA
- binding adenosine-5'-diphosphate: F34 (= F34), N36 (≠ D36), E38 (= E38), R95 (= R94), Q96 (= Q95), K98 (≠ I97), K99 (≠ A98), D100 (≠ F99), S102 (≠ P101), R103 (≠ G102), H129 (= H127), D142 (≠ R141), Y145 (≠ S147)
- binding 5-O-phosphono-alpha-D-ribofuranose: H129 (= H127), D170 (= D169), D219 (= D218), D220 (= D219), D223 (≠ S222), T224 (≠ S223), G226 (≠ R225), T227 (= T226)
Sites not aligning to the query:
P60891 Ribose-phosphate pyrophosphokinase 1; PPRibP; Phosphoribosyl pyrophosphate synthase I; PRS-I; EC 2.7.6.1 from Homo sapiens (Human) (see 5 papers)
28% identity, 88% coverage: 15:276/297 of query aligns to 16:278/318 of P60891
- S16 (≠ A15) to P: found in patients with phosphoribosyl pyrophosphate synthetase I deficiency; likely pathogenic; dbSNP:rs869025594
- D52 (≠ C51) to H: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852542
- N114 (≠ G112) to S: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852540
- L129 (≠ P126) to I: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852543
- S132 (≠ H129) mutation to A: Reduces catalytic activity.; mutation to F: No effect on catalytic activity.
- V142 (≠ L140) to L: found in a patient with an intermediate phenotype between ARTS and PRPS1 superactivity; likely pathogenic; normal PRPP synthetase activity in fibroblasts; loss of activity in erythrocytes; dbSNP:rs398122855
- N144 (≠ Q142) mutation to H: No effect on catalytic activity.
- Y146 (≠ S147) mutation to F: No effect on catalytic activity.; mutation to M: Reduces catalytic activity.
- D183 (≠ R181) to H: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852541
- A190 (≠ G188) to V: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852544
- H193 (≠ T191) to Q: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852545
- D203 (≠ E201) to H: in a breast cancer sample; somatic mutation
- V219 (≠ L217) to G: in a breast cancer sample; somatic mutation
- H231 (≠ Q229) to D: in a colorectal cancer sample; somatic mutation
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2hcrA Crystal structure of human phosphoribosyl pyrophosphate synthetase 1 in complex with amp(atp), cadmium and sulfate ion (see paper)
29% identity, 88% coverage: 15:276/297 of query aligns to 14:270/305 of 2hcrA
8dbgA Human prps1 with phosphate and atp; hexamer (see paper)
28% identity, 88% coverage: 15:276/297 of query aligns to 15:270/309 of 8dbgA
- binding adenosine-5'-triphosphate: F34 (= F34), N36 (≠ D36), E38 (= E38), R95 (= R94), Q96 (= Q95), K98 (≠ I97), H129 (= H127)
- binding phosphate ion: S46 (≠ A46), R48 (≠ L48), D216 (≠ S222), T217 (≠ S223), C218 (≠ G224), T220 (= T226)
5t3oA Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus (see paper)
29% identity, 96% coverage: 5:290/297 of query aligns to 2:293/307 of 5t3oA
7pn0A Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus at r32 space group
29% identity, 96% coverage: 5:290/297 of query aligns to 3:294/312 of 7pn0A
7yk1A Structural basis of human prps2 filaments (see paper)
29% identity, 88% coverage: 15:276/297 of query aligns to 15:268/306 of 7yk1A
- binding adenosine-5'-diphosphate: F34 (= F34), N36 (≠ D36), E38 (= E38), S46 (≠ A46), R48 (≠ L48), R95 (= R94), K99 (≠ A98), D100 (≠ F99), K101 (≠ R100), S102 (≠ P101), R103 (≠ G102), H129 (= H127), D142 (≠ R141)
- binding phosphate ion: D214 (≠ S222), C216 (≠ G224), T218 (= T226)
Sites not aligning to the query:
3mbiA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
25% identity, 87% coverage: 15:273/297 of query aligns to 15:266/287 of 3mbiA
- binding adenosine-5'-diphosphate: F34 (= F34), D36 (= D36), E38 (= E38), R93 (= R94), Q94 (= Q95), Y98 (≠ F99), H126 (= H127), K186 (= K192), R188 (= R194)
- binding magnesium ion: H95 (≠ D96), H126 (= H127)
- binding phosphate ion: R188 (= R194), S216 (= S222), T217 (≠ S223), G218 (= G224), T220 (= T226)
3mbiD Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
25% identity, 87% coverage: 15:273/297 of query aligns to 13:264/285 of 3mbiD
- binding adenosine-5'-diphosphate: F32 (= F34), D34 (= D36), E36 (= E38), R91 (= R94), Q92 (= Q95), Y96 (≠ F99), H124 (= H127), K184 (= K192), R186 (= R194)
- binding 5-O-phosphono-alpha-D-ribofuranose: R91 (= R94), H124 (= H127), K184 (= K192), R186 (= R194), D210 (= D218), D211 (= D219), I212 (= I220), S214 (= S222), T215 (≠ S223), G216 (= G224), T218 (= T226)
Q97CA5 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) (see paper)
25% identity, 87% coverage: 15:273/297 of query aligns to 13:264/286 of Q97CA5
3lpnA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with an atp analog (ampcpp). (see paper)
25% identity, 87% coverage: 15:273/297 of query aligns to 13:264/284 of 3lpnA
- binding diphosphomethylphosphonic acid adenosyl ester: F32 (= F34), D34 (= D36), E36 (= E38), R91 (= R94), Q92 (= Q95), H93 (≠ D96), Y96 (≠ F99), H124 (= H127), D125 (≠ E135)
- binding sulfate ion: R15 (= R17), S58 (≠ P61), S214 (= S222), T215 (≠ S223), G216 (= G224), T218 (= T226)
Sites not aligning to the query:
O94413 Ribose-phosphate pyrophosphokinase 2; Phosphoribosyl pyrophosphate synthase 2; EC 2.7.6.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 88% coverage: 15:275/297 of query aligns to 18:280/321 of O94413
- S172 (≠ G167) modified: Phosphoserine
7xmvA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a(amp/adp) filament bound with adp, amp and r5p (see paper)
28% identity, 88% coverage: 15:274/297 of query aligns to 18:268/307 of 7xmvA
- binding adenosine-5'-diphosphate: F33 (= F34), D35 (= D36), E37 (= E38), R94 (= R94), R97 (≠ I97), H129 (= H127)
- binding adenosine monophosphate: R97 (≠ I97), V99 (≠ F99), R100 (= R100), E131 (≠ H129), F145 (≠ V144), S147 (≠ A149), V173 (≠ Q174), A177 (≠ S178)
- binding 5-O-phosphono-alpha-D-ribofuranose: D212 (= D218), D213 (= D219), M214 (≠ I220), D216 (≠ S222), T217 (≠ S223), G219 (≠ R225), T220 (= T226)
7xmuA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a filament bound with adp, pi and r5p (see paper)
28% identity, 88% coverage: 15:274/297 of query aligns to 18:268/307 of 7xmuA
- binding adenosine-5'-diphosphate: F33 (= F34), D35 (= D36), E37 (= E38), R94 (= R94), Q95 (= Q95), R97 (≠ I97), R97 (≠ I97), R100 (= R100), H129 (= H127), E131 (≠ H129), F145 (≠ V144), S147 (≠ A149), V173 (≠ Q174)
- binding 5-O-phosphono-alpha-D-ribofuranose: D168 (= D169), D212 (= D218), M214 (≠ I220), D216 (≠ S222), T217 (≠ S223)
P0A717 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Escherichia coli (strain K12) (see 4 papers)
27% identity, 88% coverage: 15:274/297 of query aligns to 20:276/315 of P0A717
- D129 (= D125) to A: in mutant PRSA1; alters the binding of divalent cations, especially magnesium. Little alteration in the affinity for ribose 5-phosphate and 27-fold decrease of the affinity for ATP. Absence of inhibition by AMP
- D220 (= D218) mutation to E: 4-fold decrease in the affinity binding for Rib-5-P in the presence of magnesium ions. In the presence of cobalt ions, it shows a 15-fold decrease in the affinity binding for Rib-5-P.; mutation to F: With magnesium or manganese ions, the affinity binding values for ATP and Rib-5-P are comparable to those of the wild-type.
- D221 (= D219) mutation to A: The affinity binding for ATP is comparable to those of the wild-type, apart from a slight decrease in the presence of manganese ions. The affinity binding for Rib-5-P is greatly decreased in the presence of both manganese and cobalt ions but only about 2-fold in the presence of magnesium ions.
- D224 (≠ S222) mutation to A: With magnesium or manganese ions, the affinity binding values for ATP and Rib-5-P are comparable to those of the wild-type.; mutation to S: With magnesium or manganese ions, the affinity binding values for ATP and Rib-5-P are comparable to those of the wild-type.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>WP_086510738.1 NCBI__GCF_002151265.1:WP_086510738.1
MQVSLLYFDEESPAAQRLAEAVGIEALRMERHRFPDEELCLRLPDAELPECLVVYRSLNR
PNDKLVELMLLARHARERGVRRLVLVAPYLAYMRQDIAFRPGELVSQRLVGGFLAELFDA
LITVDPHLHRIERLEQAVPLRQAVALSAAPALAEAIAERRRDALLLGPDAESAQWVESAA
RATGLAYGVCTKQRHGDREVEIALPELAFAGRRVVLLDDIASSGRTLAQAARRVLAAGAA
GVDVAVTHALFAGDALSVIRQAGVEEVWSTDSIPHQSNAVLLAPALAAALGPLLDVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory