SitesBLAST
Comparing WP_086510764.1 NCBI__GCF_002151265.1:WP_086510764.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
62% identity, 99% coverage: 2:487/493 of query aligns to 3:482/488 of 8vc5A
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
49% identity, 95% coverage: 3:471/493 of query aligns to 2:467/468 of 2cv2A
- active site: K246 (= K253)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R6), A7 (= A8), S9 (= S10), G17 (= G18), I21 (= I22), E41 (= E42), Y187 (= Y194), R205 (= R212), A206 (≠ G213), E208 (= E215), W209 (= W216), L235 (= L242), L236 (= L243)
- binding : S9 (= S10), T43 (= T44), D44 (= D45), R47 (= R48), V145 (= V152), R163 (= R170), Y168 (≠ V175), E172 (≠ Q179), V177 (= V184), K180 (= K187), S181 (= S188), Y187 (= Y194), E207 (= E214), E208 (= E215), W209 (= W216), V211 (≠ N218), R237 (= R244), K241 (= K248), L272 (≠ R279), M273 (= M280), G274 (= G281), E282 (= E289), S299 (= S306), P303 (= P310), V304 (= V311), K309 (= K316), W312 (= W319), R319 (= R326), P357 (≠ T357), R358 (= R358), R417 (≠ K421), Q432 (≠ A436), R435 (≠ F439), L442 (≠ A446), E443 (≠ A447), T444 (≠ S448), G446 (≠ S450), L447 (≠ V451), F448 (≠ M452)
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
49% identity, 95% coverage: 3:471/493 of query aligns to 2:467/468 of 2cv1A
- active site: K246 (= K253)
- binding adenosine-5'-triphosphate: P8 (= P9), S9 (= S10), G17 (= G18), T18 (= T19), I21 (= I22), R47 (= R48), A206 (≠ G213), W209 (= W216), L235 (= L242), L236 (= L243)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R6), A7 (= A8), E41 (= E42), Y187 (= Y194), R205 (= R212), W209 (= W216)
- binding : S9 (= S10), E41 (= E42), T43 (= T44), D44 (= D45), R47 (= R48), V145 (= V152), R163 (= R170), V166 (≠ I173), E172 (≠ Q179), V177 (= V184), K180 (= K187), S181 (= S188), Y187 (= Y194), E207 (= E214), E208 (= E215), W209 (= W216), V211 (≠ N218), R237 (= R244), K241 (= K248), K243 (= K250), M273 (= M280), G274 (= G281), S276 (= S283), E282 (= E289), S299 (= S306), P303 (= P310), V304 (= V311), K309 (= K316), W312 (= W319), R319 (= R326), P357 (≠ T357), R358 (= R358), R417 (≠ K421), L427 (≠ M431), Q432 (≠ A436), R435 (≠ F439), L442 (≠ A446), E443 (≠ A447), T444 (≠ S448), G446 (≠ S450), L447 (≠ V451), F448 (≠ M452)
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l- glutamate (see paper)
49% identity, 95% coverage: 3:471/493 of query aligns to 2:467/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
49% identity, 95% coverage: 3:471/493 of query aligns to 2:467/468 of 1n78A
- active site: K246 (= K253)
- binding glutamol-amp: R5 (= R6), A7 (= A8), P8 (= P9), S9 (= S10), G17 (= G18), T18 (= T19), I21 (= I22), E41 (= E42), Y187 (= Y194), N191 (= N198), R205 (= R212), A206 (≠ G213), E208 (= E215), W209 (= W216), L235 (= L242), L236 (= L243)
- binding : S9 (= S10), T43 (= T44), D44 (= D45), R47 (= R48), V145 (= V152), R163 (= R170), V166 (≠ I173), Y168 (≠ V175), E172 (≠ Q179), V177 (= V184), K180 (= K187), S181 (= S188), Y187 (= Y194), E207 (= E214), E208 (= E215), W209 (= W216), L210 (≠ I217), V211 (≠ N218), R237 (= R244), K241 (= K248), M273 (= M280), G274 (= G281), E282 (= E289), R297 (= R304), P303 (= P310), V304 (= V311), K309 (= K316), W312 (= W319), R319 (= R326), P357 (≠ T357), R358 (= R358), R417 (≠ K421), L427 (≠ M431), Q432 (≠ A436), R435 (≠ F439), L442 (≠ A446), E443 (≠ A447), T444 (≠ S448), G446 (≠ S450), L447 (≠ V451), F448 (≠ M452)
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
49% identity, 95% coverage: 3:471/493 of query aligns to 2:467/468 of 1j09A
- active site: K246 (= K253)
- binding adenosine-5'-triphosphate: H15 (= H16), E208 (= E215), L235 (= L242), L236 (= L243), K243 (= K250), I244 (≠ L251), S245 (= S252), K246 (= K253), R247 (= R254)
- binding glutamic acid: R5 (= R6), A7 (= A8), S9 (= S10), E41 (= E42), Y187 (= Y194), N191 (= N198), R205 (= R212), W209 (= W216)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
49% identity, 95% coverage: 3:471/493 of query aligns to 2:467/468 of P27000
- R358 (= R358) mutation to Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
48% identity, 95% coverage: 3:471/493 of query aligns to 2:467/468 of 1g59A
- binding : D44 (= D45), R45 (= R46), A46 (≠ V47), R47 (= R48), P109 (≠ S110), V145 (= V152), R163 (= R170), V166 (≠ I173), E172 (≠ Q179), V177 (= V184), K180 (= K187), S181 (= S188), D182 (= D189), E207 (= E214), E208 (= E215), R237 (= R244), K241 (= K248), T242 (≠ S249), K243 (= K250), M273 (= M280), G274 (= G281), E282 (= E289), S299 (= S306), L300 (= L307), P303 (= P310), V304 (= V311), K309 (= K316), W312 (= W319), R319 (= R326), P357 (≠ T357), R358 (= R358), R417 (≠ K421), K426 (= K430), L427 (≠ M431), Q432 (≠ A436), R435 (≠ F439), L442 (≠ A446), E443 (≠ A447), T444 (≠ S448), P445 (≠ T449), G446 (≠ S450), L447 (≠ V451), F448 (≠ M452)
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
37% identity, 96% coverage: 2:474/493 of query aligns to 1:482/485 of 4griB
- active site: S9 (= S10), K253 (= K253)
- binding glutamic acid: R5 (= R6), A7 (= A8), S9 (= S10), E41 (= E42), Y194 (= Y194), R212 (= R212), W216 (= W216)
- binding zinc ion: C105 (= C106), C107 (≠ R108), Y128 (≠ L129), C132 (≠ D133)
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
38% identity, 96% coverage: 3:474/493 of query aligns to 103:562/564 of 3al0C
- active site: S110 (= S10), K335 (= K253)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R6), A108 (= A8), P109 (= P9), G118 (= G18), T122 (≠ I22), E142 (= E42), Y276 (= Y194), R294 (= R212), G295 (= G213), D297 (≠ E215), H298 (≠ W216), L324 (= L242), I325 (≠ L243), L333 (= L251)
- binding : T144 (= T44), D145 (= D45), R148 (= R48), Y208 (≠ R108), P213 (= P131), K252 (≠ R170), M255 (≠ I173), I266 (≠ V184), K269 (= K187), S270 (= S188), Y276 (= Y194), D297 (≠ E215), H298 (≠ W216), L299 (≠ I217), S300 (≠ N218), N301 (≠ S219), K304 (= K222), R330 (≠ K248), P332 (≠ K250), G363 (= G281), W364 (= W282), R365 (≠ S283), E370 (= E289), S387 (= S306), K389 (≠ G308), V391 (≠ P310), I392 (≠ V311), K397 (= K316), W400 (= W319), R407 (= R326), E446 (≠ T357), K447 (≠ R358), Q453 (= Q364), I457 (≠ L368), R509 (≠ K421), K520 (= K432), Q524 (≠ A436), R527 (≠ F439), V535 (≠ A447), T536 (≠ S448), G538 (≠ S450), L539 (≠ V451)
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
36% identity, 96% coverage: 3:474/493 of query aligns to 3:501/502 of 6brlA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
34% identity, 98% coverage: 1:481/493 of query aligns to 1:471/471 of P04805
- C98 (= C106) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (≠ R108) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (≠ A142) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ R144) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ R146) mutation to Q: No change in activity or in zinc content.
- H131 (≠ G148) mutation to Q: No change in activity or in zinc content.
- H132 (≠ W149) mutation to Q: No change in activity or in zinc content.
- C138 (≠ Y151) mutation to S: No change in activity or in zinc content.
- S239 (= S252) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
34% identity, 96% coverage: 1:475/493 of query aligns to 1:465/468 of 8i9iA
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
37% identity, 93% coverage: 1:458/493 of query aligns to 1:464/485 of Q8DLI5
- R6 (= R6) binding
- Y192 (= Y194) binding
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
37% identity, 93% coverage: 2:458/493 of query aligns to 1:463/484 of 2cfoA
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
38% identity, 67% coverage: 3:332/493 of query aligns to 3:303/380 of 4g6zA
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
33% identity, 52% coverage: 6:260/493 of query aligns to 19:248/308 of P27305
- E55 (= E42) binding
- Y182 (= Y194) binding
- R200 (= R212) binding
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
31% identity, 58% coverage: 3:286/493 of query aligns to 11:283/455 of 3aiiA
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
33% identity, 51% coverage: 6:254/493 of query aligns to 7:230/290 of 4a91A
- active site: S11 (= S10), K229 (= K253)
- binding glutamic acid: R7 (= R6), A9 (= A8), S11 (= S10), E43 (= E42), Y170 (= Y194), R188 (= R212), L192 (≠ W216)
- binding zinc ion: C99 (= C106), C101 (≠ R108), Y113 (≠ R120), C117 (≠ G124)
7waoA Glutamyl-tRNA synthetase from plasmodium falciparum (pfers) in complex with mn (see paper)
26% identity, 44% coverage: 2:216/493 of query aligns to 9:212/502 of 7waoA
Sites not aligning to the query:
Query Sequence
>WP_086510764.1 NCBI__GCF_002151265.1:WP_086510764.1
MTVRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDRVRSTLESERMILDS
LRWLGLEWDEGPDVGGPHGPYRQSERGDIYAEYARQLIEAGHAFKCYRTSEELDELREAR
KASGMHLALKPDDLALPDDEVARREREGWPYVVRMKVPSSGTCVIDDMLRGTIEVDWAQV
DAQVLLKSDGMPTYHLANVVDDHLMGITHVLRGEEWINSAPKHQLLYEYFGWEMPVLCHM
PLLRNPDKSKLSKRKNPTSINYYKRMGFLPQAVINYLGRMGWSMPDEREKFSLDEMMAHF
DIQRVSLGGPVFDLEKLTWLNGLYIREDLDDRAFLKALMEWAFNEEYVGQILPQVRTRVE
TLSQVAPLAGHFFSGVPDVREQDFDGIKLEREELVRLLQFLVWRFEAVPAWHKEALLAEV
KLLAGHFGFKMKDFLAPVFIAITGSAASTSVMDAMAILGSDVTRARLRHAIEVLGGVSKK
QAKRFEKEYRDLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory