Comparing WP_086510988.1 NCBI__GCF_002151265.1:WP_086510988.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
4kzkA The structure of the periplasmic l-arabinose binding protein from burkholderia thailandensis
48% identity, 91% coverage: 30:330/330 of query aligns to 1:301/301 of 4kzkA
5abpA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
47% identity, 92% coverage: 29:330/330 of query aligns to 1:302/305 of 5abpA
1abfA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
47% identity, 92% coverage: 29:330/330 of query aligns to 1:302/305 of 1abfA
1abeA Novel stereospecificity of the l-arabinose-binding protein (see paper)
47% identity, 92% coverage: 29:330/330 of query aligns to 1:302/305 of 1abeA
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
22% identity, 88% coverage: 32:322/330 of query aligns to 3:274/274 of 2ioyA
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
24% identity, 66% coverage: 48:266/330 of query aligns to 21:228/288 of 4rxmB
Sites not aligning to the query:
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
24% identity, 66% coverage: 48:266/330 of query aligns to 23:230/291 of 4rxmA
Sites not aligning to the query:
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
26% identity, 70% coverage: 32:261/330 of query aligns to 5:217/270 of 4zjpA
Sites not aligning to the query:
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
23% identity, 70% coverage: 32:261/330 of query aligns to 4:217/271 of 1dbpA
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
22% identity, 69% coverage: 41:268/330 of query aligns to 20:238/296 of 4irxA
Sites not aligning to the query:
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
22% identity, 70% coverage: 31:261/330 of query aligns to 3:225/292 of 2fn8A
Sites not aligning to the query:
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
28% identity, 27% coverage: 31:119/330 of query aligns to 4:93/297 of 4ry9B
Sites not aligning to the query:
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
28% identity, 27% coverage: 31:119/330 of query aligns to 4:93/297 of 4ry9A
Sites not aligning to the query:
>WP_086510988.1 NCBI__GCF_002151265.1:WP_086510988.1
MPITTTLSRLALGGALALATLGGAQAQDDVRIGFIVKQPEQAWFINEQRAAAERGEELGF
RVVRLAGRDGQEVLSAIDNLYSQGAQGFVICPPDVRLGPAVMNRANQYGMKVITVDDQFV
DGSGEPLEGVPHLGMSGYQIGRQVGEALAAEIEARGWDPQQVAALRITNNELPTARERTD
GASDVLLEWGFPEANIFDAPQQSTDTNSAFSAASPVLSQRSEFEHWIIYALNEESVLGGV
RATEQYGLGATDVIGVGINGSGAAFAEFSRSNPTGFHGTVAVSSTQHGRQTAENLYRWIT
EDVEPPANTETTGTLMTRDNWQDVRAELGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory