Comparing WP_086510994.1 NCBI__GCF_002151265.1:WP_086510994.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
3bqbX Hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase (see paper)
29% identity, 49% coverage: 177:363/382 of query aligns to 114:288/291 of 3bqbX
2q1cX 2-keto-3-deoxy-d-arabinonate dehydratase complexed with calcium and 2- oxobutyrate (see paper)
29% identity, 49% coverage: 177:363/382 of query aligns to 114:288/291 of 2q1cX
Sites not aligning to the query:
2q1aX 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2-oxobutyrate (see paper)
29% identity, 49% coverage: 177:363/382 of query aligns to 114:288/291 of 2q1aX
Sites not aligning to the query:
2q1dX 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate (see paper)
29% identity, 49% coverage: 177:363/382 of query aligns to 104:278/281 of 2q1dX
Sites not aligning to the query:
Q97UA0 2-dehydro-3-deoxy-D-arabinonate dehydratase; 2-keto-3-deoxy-D-arabinonate dehydratase; KdaD; EC 4.2.1.141 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
29% identity, 49% coverage: 177:363/382 of query aligns to 119:293/298 of Q97UA0
Sites not aligning to the query:
>WP_086510994.1 NCBI__GCF_002151265.1:WP_086510994.1
MNDDNTTAYLPQDLDRALLVGRVWREDVPALVAVRQGEVIDISTQCDCMADLLDRGDAAD
FARSVEGESLGSVTALLQNSLAEPQVAPYLLAPCDVQAIKACGVTFAVSLLERVIEEQAG
GDAAKASQLRAELKEMIGQDLSRIAPGSDEAMALKTALQARGAWSQYMEVGLGPDAEVFT
KAQPFSSVGFGARVGLHPASKWNNPEPEIVLAVDARGEAKGATLGNDVNLRDIEGRSALL
LGKAKDNNASCAIGPFIRLFDRDFTLDSVRQAQVTLRIQGEDDDFLLEGESDMREISRDP
LDLVRQTVGAHHQYPDGFMLFLGTMFSPIQDRDGEGQGFTHHIGDRVTIATPALGALVNR
VDRSDELPPWTYGIRQWRAHRR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory