Comparing WP_086511020.1 NCBI__GCF_002151265.1:WP_086511020.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
37% identity, 95% coverage: 20:383/383 of query aligns to 28:372/380 of 7rsfA
7uoiA Crystallographic structure of dape from enterococcus faecium
28% identity, 94% coverage: 6:366/383 of query aligns to 13:366/383 of 7uoiA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
30% identity, 81% coverage: 69:379/383 of query aligns to 72:360/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
30% identity, 81% coverage: 69:379/383 of query aligns to 73:355/360 of 2f7vA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
28% identity, 83% coverage: 51:368/383 of query aligns to 50:361/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
28% identity, 83% coverage: 51:367/383 of query aligns to 54:364/380 of 5vo3A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
27% identity, 62% coverage: 64:300/383 of query aligns to 62:302/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
27% identity, 62% coverage: 64:300/383 of query aligns to 62:302/376 of 4o23A
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
35% identity, 44% coverage: 51:217/383 of query aligns to 52:212/258 of 4h2kA
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
26% identity, 66% coverage: 25:275/383 of query aligns to 35:293/408 of Q03154
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
25% identity, 79% coverage: 66:367/383 of query aligns to 74:356/373 of 3rzaA
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
29% identity, 57% coverage: 64:281/383 of query aligns to 99:316/426 of 3pfoA
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
29% identity, 58% coverage: 51:273/383 of query aligns to 50:273/377 of 7t1qA
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
25% identity, 66% coverage: 25:275/383 of query aligns to 35:292/407 of P37111
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
41% identity, 26% coverage: 65:164/383 of query aligns to 63:165/265 of 4op4B
Sites not aligning to the query:
7lgpB Dape enzyme from shigella flexneri
28% identity, 57% coverage: 64:283/383 of query aligns to 63:268/377 of 7lgpB
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
39% identity, 25% coverage: 52:145/383 of query aligns to 81:177/475 of Q96KP4
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
35% identity, 25% coverage: 52:147/383 of query aligns to 83:181/471 of 3dljA
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
30% identity, 38% coverage: 65:211/383 of query aligns to 121:280/503 of Q8C165
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
35% identity, 25% coverage: 52:147/383 of query aligns to 114:212/507 of Q96KN2
Sites not aligning to the query:
>WP_086511020.1 NCBI__GCF_002151265.1:WP_086511020.1
MTAAEMLERLVGFATVSRDSNLDLIAFVEGYLDEHGVKHWRVESDDGRKANLLARIGPDV
EGGVVLSGHTDVVPVDGQPWSTDPFTLIDKGDGKLYGRGTCDMKGFIACALAELPEWLKR
GLDKPIYLALSYDEEVGCIGAPRMIERLMADHPRPTAVIVGEPTLMQPVVAHKGATNLRT
TVTGRASHSSQVDQGVSAIHVAARLVTKIEDVMSELRAEGRVDEAFNVAHSSLHVGKIAG
GTAINIMARECTFEWEIRHLPSDRFEELFERVNAFAAELEAEMQRRAPETSIVTEALNLT
VPALADDNNAEVLDLCRELLGEQPSGAVAYATEAGQFQRVGLPTVICGPGSIRQAHQPDE
YIEIEQLAAGTRFMQALGRRLSQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory