SitesBLAST
Comparing WP_086511056.1 NCBI__GCF_002151265.1:WP_086511056.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
28% identity, 69% coverage: 134:448/455 of query aligns to 68:389/404 of 3wx9A
- binding 2-oxoglutaric acid: D213 (= D274), P214 (≠ V275), Y215 (≠ F276), G216 (≠ A277), E217 (≠ D278), G241 (= G300), T242 (= T301), I246 (≠ T305)
- binding (2E)-pent-2-enedioic acid: Y130 (= Y196), N184 (= N245), R376 (= R435)
- binding glutamic acid: L131 (≠ Y197), V360 (≠ A417), A364 (≠ I421), R369 (≠ P426)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G170), S105 (≠ A171), Q106 (≠ N172), Y130 (= Y196), N184 (= N245), D212 (= D273), P214 (≠ V275), Y215 (≠ F276), T242 (= T301), S244 (= S303), K245 (= K304), R252 (= R311)
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
28% identity, 69% coverage: 134:448/455 of query aligns to 68:389/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: L131 (≠ Y197), Q135 (≠ G201), A364 (≠ I421), R369 (≠ P426)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: Y130 (= Y196), L131 (≠ Y197), A132 (≠ P198), N184 (= N245), R376 (= R435)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G170), S105 (≠ A171), Q106 (≠ N172), Y130 (= Y196), V179 (≠ Q240), N184 (= N245), D212 (= D273), P214 (≠ V275), Y215 (≠ F276), T242 (= T301), S244 (= S303), K245 (= K304), R252 (= R311)
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
28% identity, 69% coverage: 134:448/455 of query aligns to 68:389/404 of 3aowC
- binding 2-oxoglutaric acid: Y70 (= Y136), Y130 (= Y196), L275 (≠ V334)
- binding pyridoxal-5'-phosphate: G104 (= G170), S105 (≠ A171), Q106 (≠ N172), Y130 (= Y196), V179 (≠ Q240), N184 (= N245), D212 (= D273), P214 (≠ V275), Y215 (≠ F276), T242 (= T301), S244 (= S303), K245 (= K304), R252 (= R311)
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
28% identity, 69% coverage: 134:448/455 of query aligns to 68:389/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G170), S105 (≠ A171), Q106 (≠ N172), Y130 (= Y196), V179 (≠ Q240), N184 (= N245), D212 (= D273), P214 (≠ V275), Y215 (≠ F276), T242 (= T301), S244 (= S303), K245 (= K304), R252 (= R311)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
34% identity, 65% coverage: 128:422/455 of query aligns to 62:357/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: G99 (= G170), S100 (≠ A171), Q101 (≠ N172), Y125 (= Y196), N174 (= N245), D202 (= D273), Y205 (≠ F276), S235 (≠ T301), S237 (= S303), K238 (= K304), R245 (= R311)
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
34% identity, 65% coverage: 128:422/455 of query aligns to 62:357/397 of Q72LL6
- Y70 (= Y136) binding
- N174 (= N245) binding ; binding
- R245 (= R311) binding
Sites not aligning to the query:
- 20 S→E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- 23 R→A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; R→Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
- 40 binding
- 368 binding
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
34% identity, 65% coverage: 128:422/455 of query aligns to 58:353/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: G95 (= G170), S96 (≠ A171), Q97 (≠ N172), Y121 (= Y196), N170 (= N245), D198 (= D273), Y201 (≠ F276), S231 (≠ T301), S233 (= S303), K234 (= K304), R241 (= R311)
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
34% identity, 65% coverage: 128:422/455 of query aligns to 58:353/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G170), S96 (≠ A171), Q97 (≠ N172), Y121 (= Y196), N170 (= N245), D198 (= D273), A200 (≠ V275), Y201 (≠ F276), S231 (≠ T301), S233 (= S303), K234 (= K304), R241 (= R311)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
34% identity, 65% coverage: 128:422/455 of query aligns to 54:349/389 of 2z1yA
- binding leucine: Y117 (= Y196)
- binding pyridoxal-5'-phosphate: G91 (= G170), S92 (≠ A171), Q93 (≠ N172), Y117 (= Y196), N166 (= N245), D194 (= D273), Y197 (≠ F276), S227 (≠ T301), S229 (= S303), K230 (= K304), R237 (= R311)
Sites not aligning to the query:
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
28% identity, 69% coverage: 128:443/455 of query aligns to 59:382/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G170), S103 (≠ A171), Q104 (≠ N172), Y128 (= Y196), V177 (≠ Q240), N182 (= N245), D210 (= D273), P212 (≠ V275), Y213 (≠ F276), T240 (= T301), S242 (= S303), K243 (= K304), R250 (= R311)
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
28% identity, 63% coverage: 163:448/455 of query aligns to 105:401/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G170), S113 (≠ A171), Q114 (≠ N172), Y138 (= Y196), N194 (= N245), D222 (= D273), P224 (≠ V275), Y225 (≠ F276), T252 (= T301), S254 (= S303), K255 (= K304), R262 (= R311)
8tn3A Structure of s. Hygroscopicus aminotransferase mppq complexed with pyridoxamine 5'-phosphate (pmp) (see paper)
32% identity, 64% coverage: 162:454/455 of query aligns to 84:383/388 of 8tn3A
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
25% identity, 69% coverage: 128:439/455 of query aligns to 63:383/405 of 2zc0A
- active site: Y132 (= Y196), D214 (= D273), A216 (≠ V275), S246 (= S303)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G170), G107 (≠ A171), T108 (≠ N172), Y132 (= Y196), N186 (= N245), D214 (= D273), A216 (≠ V275), Y217 (≠ F276), T244 (= T301), S246 (= S303), K247 (= K304), R254 (= R311)
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
26% identity, 70% coverage: 132:448/455 of query aligns to 56:372/388 of 1gdeA
- active site: K232 (= K304)
- binding glutamic acid: F120 (≠ Y196), N170 (= N245), R361 (≠ N437)
- binding pyridoxal-5'-phosphate: G94 (= G170), A95 (= A171), N96 (= N172), F120 (≠ Y196), N166 (≠ L239), D198 (= D273), Y201 (≠ F276), S231 (= S303), K232 (= K304), R240 (= R311)
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
26% identity, 70% coverage: 132:448/455 of query aligns to 56:372/388 of 1gd9A
- active site: K232 (= K304)
- binding pyridoxal-5'-phosphate: G94 (= G170), A95 (= A171), N96 (= N172), F120 (≠ Y196), N170 (= N245), D198 (= D273), V200 (= V275), Y201 (≠ F276), S231 (= S303), K232 (= K304), R240 (= R311)
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
25% identity, 63% coverage: 141:425/455 of query aligns to 73:367/402 of P14909
- K203 (≠ G267) modified: N6-methyllysine; partial
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 385 modified: N6-methyllysine; partial
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
23% identity, 63% coverage: 137:422/455 of query aligns to 79:387/428 of 4gebA
- binding (5-hydroxy-4-{[(7-hydroxy-6-oxo-2-phenyl-6,7-dihydro-2H-pyrazolo[3,4-b]pyridin-5-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: S117 (≠ A171), Q118 (≠ N172), Y142 (= Y196), N202 (= N245), D230 (= D273), P232 (≠ V275), Y233 (≠ F276), S260 (≠ T301), S262 (= S303), K263 (= K304), R270 (= R311)
Sites not aligning to the query:
4ge9A Kynurenine aminotransferase ii inhibitors (see paper)
23% identity, 63% coverage: 137:422/455 of query aligns to 79:387/428 of 4ge9A
- binding (4-{[(6-benzyl-1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: S117 (≠ A171), Q118 (≠ N172), Y142 (= Y196), N202 (= N245), D230 (= D273), P232 (≠ V275), Y233 (≠ F276), S260 (≠ T301), S262 (= S303), R270 (= R311), L293 (≠ V334)
Sites not aligning to the query:
4ge7A Kynurenine aminotransferase ii inhibitors (see paper)
23% identity, 63% coverage: 137:422/455 of query aligns to 79:387/428 of 4ge7A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-6-phenoxy-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: S117 (≠ A171), Q118 (≠ N172), Y142 (= Y196), N202 (= N245), D230 (= D273), P232 (≠ V275), Y233 (≠ F276), S260 (≠ T301), S262 (= S303), R270 (= R311), L293 (≠ V334)
Sites not aligning to the query:
4gdyB Kynurenine aminotransferase ii inhibitors
23% identity, 63% coverage: 137:422/455 of query aligns to 79:387/428 of 4gdyB
- binding (5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: G116 (= G170), S117 (≠ A171), Q118 (≠ N172), Y142 (= Y196), N202 (= N245), D230 (= D273), P232 (≠ V275), S260 (≠ T301), S262 (= S303), R270 (= R311)
Sites not aligning to the query:
Query Sequence
>WP_086511056.1 NCBI__GCF_002151265.1:WP_086511056.1
MTKSGQIAEALLKAMDEGRLAPGAKVASIREAARQFGVAKNTIIDAYDQLVAMGRLQARH
GSGFFVSQARPQATVEERESLSEAIDSVSLLREQLVGSFAVRAGDGRAPASWMGGLDLTR
ALKRRGPEQDETHFEYGMPQGFEPLRDAIARVLAGRSIHAAPEQVLLTFGANHAFDLIIR
HFVDAGDSVLVETPGYYPLFGKLRLARAKLVGVSRTAKGPDLEEFERKVRQYRPRLFFLQ
PNAHNPTGTSMSLSNMHQLLKIAEQYGVVLVEDDVFADLLPQGSAHLAALDGLENVIYVG
TFSKTLSTGLRSGYIAGSRALIRSLTDIKMLTVVNSSTFIESVIHELIVKGRYRRHLVQL
RERVAKASASAQRALREVGIDDVSGPGGGYYLWARLPAGLNTLELAKRATEEGIFIAPGA
IFSLRPDGIDGTAMRINVAYANDYRFLEFLSKTLR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory