SitesBLAST
Comparing WP_086511094.1 NCBI__GCF_002151265.1:WP_086511094.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00392 Mercuric reductase; Hg(II) reductase; EC 1.16.1.1 from Pseudomonas aeruginosa (see 2 papers)
70% identity, 100% coverage: 1:363/363 of query aligns to 198:561/561 of P00392
- A211 (= A14) binding
- D403 (= D205) binding
- V411 (= V213) binding
- C558 (= C360) binding
- C559 (= C361) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 110 binding
- 130 binding
- 135 binding
- 136 modified: Disulfide link with 141, Redox-active
- 141 modified: Disulfide link with 136, Redox-active
- 145 binding
4k7zA Crystal structure of the c136(42)a/c141(47)a double mutant of tn501 mera in complex with NADP and hg2+
70% identity, 100% coverage: 1:363/363 of query aligns to 104:467/467 of 4k7zA
- active site: V186 (= V83), E190 (= E87), A321 (= A217), F439 (= F335), Y441 (= Y337), E446 (= E342), C464 (= C360), C465 (= C361)
- binding flavin-adenine dinucleotide: E116 (= E13), A117 (= A14), T146 (= T43), G147 (= G44), R269 (= R166), G308 (= G204), D309 (= D205), Q315 (≠ E211), F316 (= F212), V317 (= V213), Y318 (= Y214)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S184 (≠ A81), S185 (= S82), V186 (= V83), V187 (= V84), E190 (= E87), R207 (= R104), N208 (≠ S105), R213 (≠ Q110), T267 (= T164), G268 (= G165), R269 (= R166), Q315 (≠ E211), F316 (= F212), V346 (= V242)
Sites not aligning to the query:
- active site: 14, 38, 42, 47, 50, 76, 77
- binding flavin-adenine dinucleotide: 10, 11, 13, 15, 34, 35, 40, 41, 42, 46, 47, 51
4k8dA Crystal structure of the c558(464)a/c559(465)a double mutant of tn501 mera in complex with NADPH and hg2+
70% identity, 100% coverage: 1:363/363 of query aligns to 103:466/466 of 4k8dA
- active site: V185 (= V83), E189 (= E87), A320 (= A217), F438 (= F335), Y440 (= Y337), E445 (= E342), A463 (≠ C360), A464 (≠ C361)
- binding flavin-adenine dinucleotide: E115 (= E13), A116 (= A14), T145 (= T43), G146 (= G44), R268 (= R166), G307 (= G204), D308 (= D205), F315 (= F212), V316 (= V213), Y317 (= Y214)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S183 (≠ A81), S184 (= S82), V185 (= V83), V186 (= V84), E189 (= E87), R206 (= R104), N207 (≠ S105), R212 (≠ Q110), T266 (= T164), G267 (= G165), Q314 (≠ E211), F315 (= F212), V345 (= V242)
Sites not aligning to the query:
- active site: 13, 37, 41, 46, 49, 75, 76
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 33, 34, 39, 40, 41, 45, 46, 50
D9J041 Mercuric reductase; Hg(II) reductase; EC 1.16.1.1 from Lysinibacillus sphaericus (Bacillus sphaericus) (see paper)
45% identity, 100% coverage: 1:363/363 of query aligns to 182:546/546 of D9J041
Sites not aligning to the query:
- 122 modified: Disulfide link with 127, Redox-active
- 127 modified: Disulfide link with 122, Redox-active
P16171 Mercuric reductase; Hg(II) reductase; EC 1.16.1.1 from Bacillus cereus (see paper)
43% identity, 100% coverage: 1:363/363 of query aligns to 267:631/631 of P16171
- Y605 (= Y337) mutation to F: 10-fold decrease in activity. 300-fold decrease in activity; when associated with F-264.; mutation to H: 2-fold decrease in activity.
Sites not aligning to the query:
- 264 Y→F: 30-fold decrease in activity. 300-fold decrease in activity; when associated with F-605.
5x1yB Structure of mercuric reductase from lysinibacillus sphaericus (see paper)
44% identity, 97% coverage: 1:351/363 of query aligns to 101:453/454 of 5x1yB
- active site: Y178 (≠ V83), E182 (= E87), A318 (= A217), A437 (≠ F335), Y439 (= Y337), E444 (= E342)
- binding flavin-adenine dinucleotide: A114 (= A14), T138 (= T43), G139 (= G44), Y178 (≠ V83), R266 (= R166), G305 (= G204), D306 (= D205), F313 (= F212), V314 (= V213), A317 (= A216)
Sites not aligning to the query:
- active site: 13, 37, 41, 46, 49, 74, 75
- binding flavin-adenine dinucleotide: 9, 12, 32, 33, 34, 39, 40, 41, 45, 46, 50
4ywoA Mercuric reductase from metallosphaera sedula (see paper)
36% identity, 96% coverage: 7:354/363 of query aligns to 103:444/444 of 4ywoA
- active site: A174 (≠ V83), E178 (= E87), G308 (≠ A217), H425 (≠ F335), F427 (≠ Y337), E432 (= E342)
- binding flavin-adenine dinucleotide: A110 (= A14), A133 (≠ G42), T134 (= T43), G135 (= G44), N154 (≠ S63), L175 (≠ V84), L263 (= L173), G295 (= G204), D296 (= D205), M302 (≠ E211), L303 (≠ F212), E304 (≠ V213), A307 (= A216)
Sites not aligning to the query:
- active site: 15, 39, 43, 48, 51
- binding flavin-adenine dinucleotide: 12, 14, 36, 41, 42, 43, 47, 48, 52
6kgyB Hocl-induced flavoprotein disulfide reductase rcla from escherichia coli (see paper)
33% identity, 95% coverage: 1:345/363 of query aligns to 86:434/441 of 6kgyB
- active site: Y168 (≠ V83), E172 (= E87), H426 (≠ Y337), E431 (= E342)
- binding flavin-adenine dinucleotide: A99 (= A14), N126 (≠ G42), T127 (= T43), G128 (= G44), G291 (= G204), D292 (= D205), F299 (= F212), T300 (≠ V213), Y301 (= Y214), S303 (≠ A216), F333 (= F244)
Sites not aligning to the query:
- active site: 43, 48, 51
- binding flavin-adenine dinucleotide: 9, 12, 33, 34, 38, 41, 42, 47, 48
6kyyA Cu(ii) complex of hocl-induced flavoprotein disulfide reductase rcla from escherichia coli (see paper)
33% identity, 95% coverage: 1:345/363 of query aligns to 82:425/432 of 6kyyA
- active site: Y159 (≠ V83), E163 (= E87), H417 (≠ Y337), E422 (= E342)
- binding copper (ii) ion: H226 (≠ D149), H229 (≠ A152), T291 (≠ V213)
- binding flavin-adenine dinucleotide: A95 (= A14), N117 (≠ G42), T118 (= T43), G119 (= G44), I160 (≠ V84), R243 (= R166), D283 (= D205), F290 (= F212), T291 (≠ V213), S294 (≠ A216)
Sites not aligning to the query:
- active site: 39, 44, 47
- binding copper (ii) ion: 39, 44
- binding flavin-adenine dinucleotide: 7, 8, 29, 30, 34, 38, 39, 44, 48
1ebdA Dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase (see paper)
33% identity, 93% coverage: 7:342/363 of query aligns to 106:445/455 of 1ebdA
- active site: Y180 (≠ V83), E184 (= E87), S320 (≠ A217), H438 (≠ F335), H440 (≠ Y337), E445 (= E342)
- binding flavin-adenine dinucleotide: E112 (= E13), A113 (= A14), T141 (= T43), G142 (= G44), Y180 (≠ V83), I181 (≠ V84), R268 (= R166), D308 (= D205), A314 (≠ E211), L315 (≠ F212), A316 (≠ V213)
Sites not aligning to the query:
- active site: 13, 37, 41, 46, 49, 74, 75
- binding flavin-adenine dinucleotide: 10, 12, 13, 32, 33, 34, 39, 40, 41, 45, 46, 50
P11959 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of pyruvate complex; EC 1.8.1.4 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
33% identity, 93% coverage: 7:342/363 of query aligns to 112:451/470 of P11959
- D314 (= D205) binding
- A322 (≠ V213) binding
Sites not aligning to the query:
2yquB Crystal structures and evolutionary relationship of two different lipoamide dehydrogenase(e3s) from thermus thermophilus
34% identity, 93% coverage: 11:348/363 of query aligns to 108:445/455 of 2yquB
- active site: V177 (= V83), E181 (= E87), S314 (≠ A217), H432 (≠ F335), H434 (≠ Y337), E439 (= E342)
- binding carbonate ion: A310 (≠ V213), S314 (≠ A217), S423 (≠ T326), D426 (= D329)
- binding flavin-adenine dinucleotide: T110 (≠ E13), A111 (= A14), T137 (= T43), G138 (= G44), I178 (≠ V84), Y265 (≠ N169), G301 (= G204), D302 (= D205), M308 (≠ E211), L309 (≠ F212), A310 (≠ V213), H311 (≠ Y214)
Sites not aligning to the query:
- active site: 11, 36, 40, 45, 48, 72, 73
- binding flavin-adenine dinucleotide: 8, 10, 11, 12, 31, 32, 38, 39, 40, 42, 44, 45, 49
2yquA Crystal structures and evolutionary relationship of two different lipoamide dehydrogenase(e3s) from thermus thermophilus
34% identity, 93% coverage: 11:348/363 of query aligns to 108:445/455 of 2yquA
- active site: V177 (= V83), E181 (= E87), S314 (≠ A217), H432 (≠ F335), H434 (≠ Y337), E439 (= E342)
- binding flavin-adenine dinucleotide: T110 (≠ E13), A111 (= A14), T137 (= T43), G138 (= G44), S157 (= S63), I178 (≠ V84), Y265 (≠ N169), G301 (= G204), D302 (= D205), M308 (≠ E211), L309 (≠ F212), A310 (≠ V213)
Sites not aligning to the query:
- active site: 11, 36, 40, 45, 48, 72, 73
- binding flavin-adenine dinucleotide: 8, 10, 11, 12, 31, 32, 38, 39, 40, 42, 44, 45, 49
2eq7A Crystal structure of lipoamide dehydrogenase from thermus thermophilus hb8 with psbdo
34% identity, 93% coverage: 11:348/363 of query aligns to 108:445/452 of 2eq7A
- active site: V177 (= V83), E181 (= E87), S314 (≠ A217), H432 (≠ F335), H434 (≠ Y337), E439 (= E342)
- binding flavin-adenine dinucleotide: T110 (≠ E13), A111 (= A14), T137 (= T43), G138 (= G44), S157 (= S63), I178 (≠ V84), R262 (= R166), Y265 (≠ N169), D302 (= D205), M308 (≠ E211), L309 (≠ F212), A310 (≠ V213), H311 (≠ Y214), Y341 (≠ F244)
- binding nicotinamide-adenine-dinucleotide: W146 (≠ I52), G174 (= G80), G176 (≠ S82), V177 (= V83), I178 (≠ V84), E197 (≠ A103), Y198 (≠ R104), V231 (≠ A136), V260 (≠ T164), G261 (= G165), R262 (= R166), M308 (≠ E211), L309 (≠ F212), V339 (= V242)
Sites not aligning to the query:
- active site: 11, 36, 40, 45, 48, 72, 73
- binding flavin-adenine dinucleotide: 10, 11, 12, 31, 32, 38, 39, 40, 42, 44, 45, 49
1dxlA Dihydrolipoamide dehydrogenase of glycine decarboxylase from pisum sativum (see paper)
32% identity, 96% coverage: 7:355/363 of query aligns to 108:465/467 of 1dxlA
- active site: Y184 (≠ V83), E188 (= E87), H444 (≠ F335), H446 (≠ Y337), E451 (= E342)
- binding flavin-adenine dinucleotide: Y114 (≠ E13), G115 (≠ A14), T144 (= T43), G145 (= G44), Y184 (≠ V83), I185 (≠ V84), R274 (= R166), D314 (= D205), M320 (≠ E211), L321 (≠ F212), A322 (≠ V213), H323 (≠ Y214)
Sites not aligning to the query:
- active site: 38, 42, 47, 50
- binding flavin-adenine dinucleotide: 9, 13, 14, 33, 34, 35, 40, 41, 42, 46, 47, 51
P31023 Dihydrolipoyl dehydrogenase, mitochondrial; Dihydrolipoamide dehydrogenase; Glycine cleavage system L protein; Pyruvate dehydrogenase complex E3 subunit; E3; PDC-E3; EC 1.8.1.4 from Pisum sativum (Garden pea) (Lathyrus oleraceus) (see 2 papers)
32% identity, 96% coverage: 7:355/363 of query aligns to 142:499/501 of P31023
Sites not aligning to the query:
- 1:31 modified: transit peptide, Mitochondrion
- 67:76 binding
- 76 modified: Disulfide link with 81, Redox-active
- 81 modified: Disulfide link with 76, Redox-active
4jdrA Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase from escherichia coli (see paper)
32% identity, 97% coverage: 7:358/363 of query aligns to 109:465/471 of 4jdrA
- active site: I184 (≠ V83), E188 (= E87), V324 (≠ A217), H442 (≠ F335), H444 (≠ Y337), E449 (= E342)
- binding flavin-adenine dinucleotide: L115 (≠ E13), G116 (≠ A14), A144 (≠ T43), G145 (= G44), I185 (≠ V84), G311 (= G204), D312 (= D205), M318 (≠ E211), L319 (≠ F212), A320 (≠ V213), H321 (≠ Y214)
Sites not aligning to the query:
- active site: 15, 40, 44, 49, 52, 77, 78, 467, 468
- binding flavin-adenine dinucleotide: 12, 14, 15, 16, 35, 36, 37, 43, 44, 48, 49, 53
P0A9P0 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of pyruvate and 2-oxoglutarate dehydrogenases complexes; Glycine cleavage system L protein; EC 1.8.1.4 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 97% coverage: 7:358/363 of query aligns to 110:466/474 of P0A9P0
- K220 (≠ A121) modified: N6-acetyllysine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6uziC Crystal structure of dihydrolipoyl dehydrogenase from elizabethkingia anophelis nuhp1
31% identity, 96% coverage: 1:348/363 of query aligns to 105:459/470 of 6uziC
- active site: V187 (= V83), E191 (= E87), H448 (≠ Y337), E453 (= E342)
- binding flavin-adenine dinucleotide: V117 (≠ E13), G118 (≠ A14), T147 (= T43), G148 (= G44), I188 (≠ V84), R276 (= R166), D316 (= D205), M322 (≠ E211), L323 (≠ F212), A324 (≠ V213)
- binding zinc ion: H448 (≠ Y337), E453 (= E342)
Sites not aligning to the query:
- active site: 45, 50, 53
- binding flavin-adenine dinucleotide: 12, 13, 15, 16, 17, 36, 37, 43, 44, 45, 49, 50, 53, 54
6awaA 1.83 angstrom resolution crystal structure of dihydrolipoyl dehydrogenase from pseudomonas putida in complex with fad and adenosine-5'-monophosphate.
31% identity, 93% coverage: 7:344/363 of query aligns to 115:458/475 of 6awaA
- active site: V191 (= V83), E195 (= E87), F449 (= F335), H451 (≠ Y337), E456 (= E342)
- binding adenosine monophosphate: I187 (= I79), E211 (vs. gap), A212 (= A103), L213 (≠ R104), V245 (≠ A136), V277 (≠ T164)
- binding flavin-adenine dinucleotide: H121 (≠ E13), G122 (≠ A14), S151 (≠ T43), G152 (= G44), I192 (≠ V84), R279 (= R166), G318 (= G204), D319 (= D205), M325 (≠ E211), L326 (≠ F212), A327 (≠ V213), Y358 (≠ F244)
Sites not aligning to the query:
- active site: 45, 49, 54, 57, 474, 475
- binding flavin-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 48, 49, 53, 54, 58
Query Sequence
>WP_086511094.1 NCBI__GCF_002151265.1:WP_086511094.1
LRDHPAITVLHGEARFIDAHSLMVKLNEGGEQVVHFDRALIGTGARPAVPPIPGLADTPY
LTSTSALALDTLPERLIVIGASVVALELAQAFARLGSRVTVLARSRLLSQEDPAVGDAVE
AAFRRESIEVLKQTQASRVDYTDNEFIVDTNAGTLRADQLLVATGRTPNTEALNLASLGV
ETARGAILVDEHLHTTVPGLYAAGDCTDQPEFVYVAAAGGSRAAVNMTGGEATLDLSAMP
AVIFTDPQVATVGLTEAEAIEQGFSVDTRELDLENVPRALVNFDTGGFIKLVAERDSGRL
LGVQAVAGEAGELIQTAVMALRARMTVHDIANELFPYLTMVEGLKLCAQTFTKDVTQLSC
CAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory