Comparing WP_086511125.1 NCBI__GCF_002151265.1:WP_086511125.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
32% identity, 96% coverage: 1:475/495 of query aligns to 5:501/506 of 3i8bA
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
33% identity, 99% coverage: 1:488/495 of query aligns to 1:482/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
32% identity, 99% coverage: 1:488/495 of query aligns to 1:474/476 of 2itmA
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
24% identity, 99% coverage: 3:491/495 of query aligns to 6:489/492 of 3ll3A
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
24% identity, 99% coverage: 3:491/495 of query aligns to 5:487/490 of 3ll3B
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
28% identity, 84% coverage: 1:416/495 of query aligns to 4:423/498 of 3kzbA
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
26% identity, 94% coverage: 3:468/495 of query aligns to 6:467/478 of 5ya2A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
26% identity, 94% coverage: 3:468/495 of query aligns to 6:467/478 of 5ya1A
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
25% identity, 99% coverage: 3:491/495 of query aligns to 2:479/485 of 6k76A
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
24% identity, 88% coverage: 3:439/495 of query aligns to 8:447/501 of O34154
Sites not aligning to the query:
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
25% identity, 93% coverage: 3:463/495 of query aligns to 6:478/497 of O86033
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
23% identity, 90% coverage: 3:447/495 of query aligns to 6:459/498 of Q5HGD2
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
23% identity, 90% coverage: 3:447/495 of query aligns to 7:460/499 of 3ge1A
4bc2A Crystal structure of human d-xylulokinase in complex with d-xylulose and adenosine diphosphate (see paper)
23% identity, 97% coverage: 3:482/495 of query aligns to 7:516/528 of 4bc2A
4bc5A Crystal structure of human d-xylulokinase in complex with inhibitor 5- deoxy-5-fluoro-d-xylulose (see paper)
23% identity, 97% coverage: 3:482/495 of query aligns to 5:514/524 of 4bc5A
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
21% identity, 90% coverage: 3:447/495 of query aligns to 6:459/496 of P18157
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
22% identity, 89% coverage: 1:439/495 of query aligns to 4:443/495 of 6udeB
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
24% identity, 92% coverage: 3:457/495 of query aligns to 6:460/494 of 1gllO
1gljO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
24% identity, 92% coverage: 3:457/495 of query aligns to 6:460/494 of 1gljO
1bwfO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
24% identity, 92% coverage: 3:457/495 of query aligns to 6:460/494 of 1bwfO
>WP_086511125.1 NCBI__GCF_002151265.1:WP_086511125.1
MYIGVDCGTQSTKVVVVDVEGEAILGEASRAHRLSEGDNGRREQQPQEWVEAFRGAFEEA
VTRAGIERHAIRAIGVSGQQHGMVALDAEGLPVHPAKLWCDTETAAHNAALVARLGGAAG
CLERLGLVLQTGYTASKIAWLRDTNPCAYRRIESVLLPHDYLNFWLTGEKVAEAGDASGT
GYFDTRTRRWRHDVFAEIAPELDPTRVLPRLIDSREPAGTLRPELARELGLSPDVVVASG
GGDNMLGAIGTGNIAPGIVTLSLGTSGTVCAYSPESVRAESDMVANFCASHGGWLPLICT
MNVTSASTLVRELFDLDLAAFGERLAAAPIGAEGVTVLPFFNGERVPSLPHATASFLGLD
SRNLTQANLCRAVVESATFGLRYGLELLGPLAAGASQIRLIGGGARSPVWRQMVADVTAT
PVICPQVTDAAALGAALQAAWCERHDLPLSELCERLVHLDDASLAEPKAASVRAYETVYA
RYREALALQHGVPVG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory