Comparing WP_086511196.1 NCBI__GCF_002151265.1:WP_086511196.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hz2B Crystal structure of glutathione s-transferase xaut_3756 (target efi- 507152) from xanthobacter autotrophicus py2
37% identity, 94% coverage: 1:192/204 of query aligns to 2:195/206 of 4hz2B
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
35% identity, 95% coverage: 2:195/204 of query aligns to 4:199/201 of 3m3mA
3wywB Structural characterization of catalytic site of a nilaparvata lugens delta-class glutathione transferase (see paper)
30% identity, 94% coverage: 1:192/204 of query aligns to 3:195/214 of 3wywB
4gsnB Crystal structure of gste2 zan/u variant from anopheles gambiae (see paper)
32% identity, 93% coverage: 3:192/204 of query aligns to 5:195/220 of 4gsnB
2imkA Structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt- detoxifying activity (see paper)
32% identity, 93% coverage: 3:192/204 of query aligns to 5:195/220 of 2imkA
Sites not aligning to the query:
1pn9A Crystal structure of an insect delta-class glutathione s-transferase from a ddt-resistant strain of the malaria vector anopheles gambiae (see paper)
30% identity, 94% coverage: 1:192/204 of query aligns to 1:193/209 of 1pn9A
Sites not aligning to the query:
3zmkB Anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa (see paper)
31% identity, 93% coverage: 3:192/204 of query aligns to 8:198/222 of 3zmkB
4i97A The crystal structure of glutathione s-transferase sniggstd1a from scaptomyza nigrita in complex with glutathione
29% identity, 93% coverage: 3:192/204 of query aligns to 3:193/207 of 4i97A
5f06A Crystal structure of glutathione transferase f7 from populus trichocarpa (see paper)
29% identity, 94% coverage: 1:192/204 of query aligns to 2:204/213 of 5f06A
7rhpA Crystal structure of honeybee (apis mellifera) glutathione s- transferase amgstd1 (see paper)
26% identity, 100% coverage: 1:203/204 of query aligns to 8:209/215 of 7rhpA
1jlvA Anopheles dirus species b glutathione s-transferases 1-3 (see paper)
28% identity, 92% coverage: 1:188/204 of query aligns to 1:188/207 of 1jlvA
5hfkA Crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. Sakai (ecs3186, target efi-507414) with bound glutathione
27% identity, 91% coverage: 5:190/204 of query aligns to 5:197/207 of 5hfkA
4pnfB Glutathione s-transferase from drosophila melanogaster - isozyme e6 (see paper)
32% identity, 94% coverage: 1:192/204 of query aligns to 3:197/221 of 4pnfB
3makA Crystal structure of glutathione transferase dmgstd1 from drosophila melanogaster, in complex with glutathione (see paper)
28% identity, 94% coverage: 1:192/204 of query aligns to 1:193/208 of 3makA
P20432 Glutathione S-transferase D1; DDT-dehydrochlorinase; EC 2.5.1.18; EC 4.5.1.1 from Drosophila melanogaster (Fruit fly) (see paper)
28% identity, 94% coverage: 1:192/204 of query aligns to 2:194/209 of P20432
3f63A Crystal structure of a delta class gst (adgstd4-4) from anopheles dirus, in complex with s-hexyl glutathione (see paper)
28% identity, 95% coverage: 1:194/204 of query aligns to 1:200/218 of 3f63A
3gx0A Crystal structure of gsh-dependent disulfide bond oxidoreductase (see paper)
27% identity, 91% coverage: 5:190/204 of query aligns to 5:197/204 of 3gx0A
P77526 Disulfide-bond oxidoreductase YfcG; GSH-dependent disulfide-bond oxidoreductase YfcG; GST N1-1; GST-like protein YfcG; Organic hydroperoxidase; EC 1.8.4.-; EC 1.11.1.- from Escherichia coli (strain K12) (see 2 papers)
27% identity, 91% coverage: 5:190/204 of query aligns to 5:197/215 of P77526
1byeA Glutathione s-transferase i from mais in complex with atrazine glutathione conjugate (see paper)
31% identity, 89% coverage: 1:182/204 of query aligns to 3:192/213 of 1byeA
1axdA Structure of glutathione s-transferase-i bound with the ligand lactoylglutathione (see paper)
31% identity, 89% coverage: 1:182/204 of query aligns to 3:192/209 of 1axdA
>WP_086511196.1 NCBI__GCF_002151265.1:WP_086511196.1
MKLYHFPLSGHAHRAALFLSLAGVEHELIEVDLAAGAHKQPEFLALNAFGEVPVLDDNGT
VIADSLAILVYVARKIGPSHWLPTEPADEAQVQRWLSVAAGKIAYGACAARLITVFGAPF
RAEEVIGRAHATLAVMEQTLEGQRWIAGTAQPTIADVALYSYVERAPEGNVDLSSYPSVR
AWLRQIERLPGFVPFQRTRAGLEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory