SitesBLAST
Comparing WP_086511203.1 NCBI__GCF_002151265.1:WP_086511203.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
30% identity, 93% coverage: 46:714/720 of query aligns to 20:718/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (= M64), G39 (= G65), Q40 (= Q66), H41 (≠ G67), V42 (≠ T68), A45 (≠ G71), G79 (≠ V109), G80 (= G110), S81 (= S111), S83 (≠ G113), V84 (≠ I114), G374 (= G391), F375 (= F392), L379 (≠ T396), L499 (≠ W516), R500 (= R517), V624 (≠ I620), D625 (≠ N621), Q632 (= Q628), T687 (≠ G683), G688 (= G684), L689 (≠ V685), G690 (= G686), E691 (= E687)
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
25% identity, 51% coverage: 184:547/720 of query aligns to 10:380/731 of 5g5gC
Sites not aligning to the query:
- active site: 692, 693
- binding pterin cytosine dinucleotide: 468, 469, 470, 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
25% identity, 51% coverage: 184:547/720 of query aligns to 10:380/732 of P77489
Sites not aligning to the query:
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
- 511:512 binding
- 615:621 binding
- 625 binding
- 688:691 binding
- 692 E→Q: Loss of activity.
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
25% identity, 51% coverage: 193:558/720 of query aligns to 8:385/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
23% identity, 38% coverage: 184:454/720 of query aligns to 536:832/1286 of 4yswA
Sites not aligning to the query:
- active site: 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 848, 880, 881, 882, 885, 886, 889
- binding calcium ion: 838, 841, 842, 845, 878, 879
- binding flavin-adenine dinucleotide: 44, 226, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 312, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374, 399
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 113, 145, 147
- binding 1,4-dihydronicotinamide adenine dinucleotide: 233, 326, 327, 328, 363, 364, 400, 401, 428, 430, 431, 471, 478, 1196
- binding uric acid: 851, 885, 980, 981, 1050, 1232
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
23% identity, 38% coverage: 184:454/720 of query aligns to 536:832/1291 of 6a7xB
Sites not aligning to the query:
- active site: 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 880, 881, 885, 886, 889
- binding flavin-adenine dinucleotide: 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 312, 317, 320, 321, 323, 324, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 428, 430, 431, 471, 478
- binding uric acid: 851, 885, 980, 981, 1049, 1050, 1232
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
23% identity, 38% coverage: 184:454/720 of query aligns to 538:834/1291 of 2e3tA
Sites not aligning to the query:
- active site: 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 850, 882, 883, 887, 888, 891
- binding calcium ion: 840, 843, 844, 847, 880, 881
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 113, 145, 147
- binding uric acid: 853, 887, 982, 983, 1051, 1052, 1234
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
23% identity, 38% coverage: 184:454/720 of query aligns to 538:834/1295 of 6a7xA
Sites not aligning to the query:
- active site: 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 850, 883, 884, 887, 888, 891
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 314, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 329, 365, 366, 432, 433, 473, 480
- binding uric acid: 853, 887, 982, 983, 1052, 1234
P22985 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Rattus norvegicus (Rat) (see 2 papers)
23% identity, 38% coverage: 184:454/720 of query aligns to 565:861/1331 of P22985
Sites not aligning to the query:
- 43 binding
- 48 binding
- 51 binding
- 73 binding
- 112 binding
- 115 binding
- 147 binding
- 149 binding
- 256:263 binding
- 335:336 WF→AL: Converts the enzyme to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- 346:350 binding
- 359 binding
- 403 binding
- 535 C→A: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with R-992. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with R-992 and S-1316.
- 992 C→R: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with A-535. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and S-1316.
- 1316 C→S: Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and R-992.
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
24% identity, 50% coverage: 187:547/720 of query aligns to 3:381/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 50% coverage: 187:547/720 of query aligns to 2:380/420 of 3hrdE
- active site: Q207 (= Q361), L242 (≠ T396), R318 (≠ Q474), H322 (≠ N478), R350 (≠ N524)
- binding calcium ion: T206 (= T360), N208 (≠ G362), D212 (≠ I366), K241 (= K395), L242 (≠ T396), D243 (≠ H397)
- binding pterin cytosine dinucleotide: G237 (= G391), F238 (= F392), R350 (≠ N524)
- binding selenium atom: F238 (= F392), A348 (≠ T522), F349 (= F523), R350 (≠ N524)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 50% coverage: 187:547/720 of query aligns to 2:380/420 of 3hrdA
- active site: Q207 (= Q361), L242 (≠ T396), R318 (≠ Q474), H322 (≠ N478), R350 (≠ N524)
- binding pterin cytosine dinucleotide: G236 (= G390), G237 (= G391), F238 (= F392), R350 (≠ N524)
- binding magnesium ion: T206 (= T360), N208 (≠ G362), D212 (≠ I366), K241 (= K395), L242 (≠ T396), D243 (≠ H397), T305 (≠ M461), Y308 (≠ A464), A309 (≠ Y465), S346 (≠ A520)
- binding nicotinic acid: A314 (≠ E470), R318 (≠ Q474), F352 (= F526)
- binding selenium atom: F238 (= F392), G239 (= G393), A348 (≠ T522), F349 (= F523), R350 (≠ N524)
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
36% identity, 19% coverage: 580:715/720 of query aligns to 611:754/769 of O33819
- VGKALN 650:655 (≠ CGHAIN 616:621) binding
- KEAS 722:725 (vs. gap) binding
Sites not aligning to the query:
- 214 binding
- 244:245 binding
- 522:526 binding
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
36% identity, 19% coverage: 580:715/720 of query aligns to 603:746/761 of 1rm6A
- active site: E718 (= E687), G719 (≠ P688)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): L646 (≠ I620), N647 (= N621), V651 (= V625), Q654 (= Q628), K714 (vs. gap), E715 (vs. gap), A716 (vs. gap), S717 (vs. gap), E718 (= E687)
Sites not aligning to the query:
- active site: 206, 241, 318, 322, 350
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 235, 236, 237, 238, 350, 473, 474, 475, 476, 513, 514, 515, 517, 518
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
23% identity, 37% coverage: 188:454/720 of query aligns to 544:836/1307 of 2e1qA
- active site: Q742 (= Q361), V777 (≠ T396)
- binding bicarbonate ion: R814 (= R432), H815 (≠ Q433)
- binding calcium ion: E715 (≠ T336), H716 (= H337), Y718 (≠ C339), T741 (= T360), T747 (≠ I366), S780 (≠ E399), T781 (≠ I400), S784 (≠ Q403), T811 (≠ G429), G812 (≠ Q430)
- binding fe2/s2 (inorganic) cluster: L719 (≠ M340)
- binding hydroxy(dioxo)molybdenum: F773 (= F392), G774 (= G393)
Sites not aligning to the query:
- active site: 855, 859, 887, 1235, 1236
- binding bicarbonate ion: 852, 886, 889, 890, 893
- binding flavin-adenine dinucleotide: 43, 44, 230, 231, 232, 233, 234, 235, 236, 237, 238, 311, 312, 316, 320, 321, 324, 325, 327, 328, 333, 334, 377, 378
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding hydroxy(dioxo)molybdenum: 887, 1053, 1054, 1236
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
23% identity, 37% coverage: 188:454/720 of query aligns to 570:862/1333 of P47989
- D584 (≠ P202) to A: in dbSNP:rs45491693
- R607 (≠ A224) to Q: in dbSNP:rs45442092
- K617 (≠ D234) to N: in dbSNP:rs45442398
- T623 (≠ E240) to I: in dbSNP:rs45448694
- I646 (≠ V260) to V: in dbSNP:rs17323225
- I703 (= I293) to V: in dbSNP:rs17011368
- L763 (= L356) to F: in a breast cancer sample; somatic mutation
- R791 (≠ N384) to G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
Sites not aligning to the query:
- 133 E → K: in dbSNP:rs45447191
- 172 G → R: in dbSNP:rs45523133
- 235 T → M: in dbSNP:rs45469499
- 257:264 binding
- 337 binding
- 347:351 binding
- 360 binding
- 395 K → M: in dbSNP:rs34929837
- 422 binding
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 555 P → S: in dbSNP:rs45577338
- 910 T → M: in dbSNP:rs669884
- 993 modified: Disulfide link with 536, In oxidase form
- 1091 V → L: in dbSNP:rs45619033
- 1109 N → T: in dbSNP:rs45547640
- 1150 P → R: in dbSNP:rs1042036
- 1176 R → C: in dbSNP:rs45624433
- 1296 R → W: in dbSNP:rs45564939
- 1318 modified: Disulfide link with 509, In oxidase form
2ckjA Human milk xanthine oxidoreductase
23% identity, 37% coverage: 188:454/720 of query aligns to 513:805/1264 of 2ckjA
Sites not aligning to the query:
- active site: 824, 828, 856, 1204, 1205
- binding flavin-adenine dinucleotide: 228, 230, 231, 232, 233, 234, 308, 309, 317, 318, 321, 322, 324, 325, 331, 375
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 147, 148
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
23% identity, 50% coverage: 193:551/720 of query aligns to 15:405/786 of 1t3qB
Sites not aligning to the query:
- active site: 743, 744
- binding pterin cytosine dinucleotide: 506, 507, 508, 510, 513, 545, 547, 549, 550, 666, 670, 674, 675, 678, 739, 740, 741, 742
3unaA Crystal structure of bovine milk xanthine dehydrogenase with NAD bound (see paper)
23% identity, 36% coverage: 193:454/720 of query aligns to 536:823/1286 of 3unaA
Sites not aligning to the query:
- active site: 842, 846, 874, 1222, 1223
- binding calcium ion: 829, 832, 833, 836, 869, 870
- binding carbonate ion: 871, 872, 876, 877, 880
- binding flavin-adenine dinucleotide: 43, 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 430, 431, 471, 478
3nvyC Crystal structure of bovine xanthine oxidase in complex with quercetin (see paper)
23% identity, 36% coverage: 193:454/720 of query aligns to 4:291/756 of 3nvyC
Sites not aligning to the query:
- active site: 310, 314, 342, 690, 691
- binding 3,5,7,3',4'-pentahydroxyflavone: 303, 310, 344, 439, 440, 444, 509
Query Sequence
>WP_086511203.1 NCBI__GCF_002151265.1:WP_086511203.1
MKPQNIHLTRRSFLAGAVAAGAALVVPLRLPAWAQQSDDASISQAFIRIDTNGQVTFVLP
TSEMGQGTHTGQAQILAEELGADWSSIAVEMPNQPAPAYRIPSGQMRSVGSFGIRLWHDP
LRRAAAQAREMLTQAAATRLGVEPATLQAEDGFIVHAASGRSLPFGDLVGDAAALPVPEE
PTLRPDQERTLTGRSVPRLDTPLKVTGKAVYAVDVEREGMLHGAVRLAPVFSADVESLDE
SSVSGMPGVVAVVRVPRGAVVVAESWWQAKQAADALDITFTQTPADTLSTDEINELLREG
LDRTDVPVTTLRGEAEATLSTAGQVVEAEYSVPLLTHMCMEPINCTAESTEERTELWIGT
QGQDVIRMTLESAMQVPAEQLFINTTYLGGGFGRKTHGEIALQAALASRAVGGRPVKVLW
AREDDVQQGQYRQTMMCRFRAVLDDDGNITGMHIRLAGPQMGRAYGFDPEQMAQATGNLA
NFDPFSLGGLSDMRYVIPNFVVEHAVVDLPIPLCPWRAIAHTFNGFFFESFMDECAAAAG
RDPLEYRRSHCAGQTRMLAVLDRVAEMSRWSEPAPEGLSRGLAVVESYGSYVAQVVEARA
NGESVRVEQVYVAIDCGHAINPGQVEAQMQGSVVDALGAALRQKVTIRDGRAEQSNFYDY
SLLRMGEEPSVAVGIVEIGSPLGGVGEPGIPPLAPALANALFAATQQRIRHLPLSDHFPS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory