Comparing WP_086511264.1 NCBI__GCF_002151265.1:WP_086511264.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P70994 2-hydroxymuconate tautomerase; (2Z,4E)-2-hydroxyhexa-2,4-dienedioate keto-enol isomerase; 4-oxalocrotonate tautomerase; 4-OT; EC 5.3.2.6 from Bacillus subtilis (strain 168) (see paper)
38% identity, 91% coverage: 1:59/65 of query aligns to 1:60/62 of P70994
2opaA Ywhb binary complex with 2-fluoro-p-hydroxycinnamate
37% identity, 89% coverage: 2:59/65 of query aligns to 1:59/61 of 2opaA
Sites not aligning to the query:
>WP_086511264.1 NCBI__GCF_002151265.1:WP_086511264.1
MPIVTIQQFPRDLTQKRELAQRITQAFVEVYGTPEESVQVFFSEVDGENWAKAGKMGCDR
QQGQG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory