SitesBLAST
Comparing WP_086511383.1 NCBI__GCF_002151265.1:WP_086511383.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
46% identity, 51% coverage: 258:589/655 of query aligns to 1:319/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G288), G34 (= G291), T35 (≠ S292), I36 (= I293), D56 (= D313), H57 (≠ I314), S82 (= S345), I83 (≠ V346), A104 (= A367), A105 (= A368), A106 (= A369), K108 (= K371), N123 (= N386), I146 (≠ V409), K162 (= K425), F184 (= F449), G185 (= G450), N186 (= N451), V187 (= V452), S190 (= S455), S191 (= S456)
- binding uridine-5'-diphosphate: K150 (= K413), N186 (= N451), S193 (= S458), V194 (= V459), T209 (= T474), L210 (≠ V475), T211 (= T476), I215 (= I480), R217 (= R482), E279 (= E553)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
46% identity, 51% coverage: 258:589/655 of query aligns to 1:319/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G288), G34 (= G291), T35 (≠ S292), I36 (= I293), D56 (= D313), H57 (≠ I314), S82 (= S345), I83 (≠ V346), A104 (= A367), A105 (= A368), A106 (= A369), K108 (= K371), N123 (= N386), I146 (≠ V409), K162 (= K425), F184 (= F449), G185 (= G450), N186 (= N451), V187 (= V452), S190 (= S455), S191 (= S456)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K371), H109 (= H372), T148 (= T411), G185 (= G450), N186 (= N451), S193 (= S458), V194 (= V459), T209 (= T474), L210 (≠ V475), T211 (= T476), I215 (= I480), R217 (= R482), R276 (= R550), E279 (= E553)
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
36% identity, 44% coverage: 279:564/655 of query aligns to 3:276/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G288), T14 (≠ G290), G15 (= G291), T16 (≠ S292), I17 (= I293), S37 (≠ D313), R38 (≠ I314), S39 (= S315), D63 (≠ S345), I64 (≠ V346), V83 (≠ A367), A84 (= A368), K87 (= K371), T125 (≠ V409), S127 (≠ T411), Y137 (≠ M421), K141 (= K425), F167 (= F449), V170 (= V452), S173 (= S455), R174 (≠ S456)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K371), H88 (= H372), S127 (≠ T411), N128 (≠ D412), Y137 (≠ M421), N169 (= N451), S176 (= S458), V177 (= V459), L180 (= L462), T192 (= T474), T194 (= T476), M198 (≠ I480), R200 (= R482), L234 (≠ I517), E265 (= E553)
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
35% identity, 44% coverage: 282:566/655 of query aligns to 14:279/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K371), Q94 (≠ H372), N175 (= N451), S179 (= S455), R180 (≠ S456), S182 (= S458), V183 (= V459), L186 (= L462), T198 (= T474), I199 (≠ V475), T200 (= T476), M204 (≠ I480), R206 (= R482), V240 (≠ I517), R263 (= R550), E266 (= E553)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
35% identity, 44% coverage: 282:566/655 of query aligns to 14:279/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G288), T22 (≠ G290), G23 (= G291), S24 (= S292), F25 (≠ I293), S45 (≠ A318), R46 (≠ L319), D47 (≠ Y320), K50 (≠ E323), D69 (≠ S345), V70 (= V346), A89 (= A367), A90 (= A368), A91 (= A369), K93 (= K371), L131 (≠ V409), T133 (= T411), K147 (= K425), Y173 (≠ F449)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (≠ H372), V95 (= V373), K135 (= K413), N175 (= N451), S182 (= S458), V183 (= V459), L186 (= L462), T198 (= T474), T200 (= T476), M204 (≠ I480), V240 (≠ I517), R263 (= R550), E266 (= E553), Y278 (≠ V565)
Sites not aligning to the query:
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: 313, 314, 315, 316, 320
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
35% identity, 44% coverage: 282:566/655 of query aligns to 6:271/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G288), T14 (≠ G290), G15 (= G291), F17 (≠ I293), S37 (≠ A318), R38 (≠ L319), D39 (≠ Y320), K42 (≠ E323), D61 (≠ S345), V62 (= V346), R63 (≠ Q347), A81 (= A367), A82 (= A368), A83 (= A369), K85 (= K371), S124 (= S410), T125 (= T411), K139 (= K425), Y165 (≠ F449), G166 (= G450)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
36% identity, 43% coverage: 279:560/655 of query aligns to 2:265/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G288), T13 (≠ G290), G14 (= G291), S15 (= S292), F16 (≠ I293), S36 (≠ A318), R37 (≠ L319), D38 (≠ Y320), K41 (≠ E323), D60 (≠ S345), V61 (= V346), A80 (= A367), A81 (= A368), A82 (= A369), K84 (= K371), T99 (≠ N386), L122 (≠ V409), K138 (= K425), Y164 (≠ F449)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
28% identity, 45% coverage: 268:564/655 of query aligns to 1:272/333 of O25511
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
28% identity, 44% coverage: 279:564/655 of query aligns to 2:266/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G288), T13 (≠ G290), G14 (= G291), S15 (= S292), F16 (≠ I293), S37 (≠ A318), R38 (≠ L319), D39 (≠ Y320), K42 (≠ E323), D61 (≠ S345), V62 (= V346), A81 (= A367), A82 (= A368), A83 (= A369), K85 (= K371), T100 (≠ N386), L123 (≠ V409), S124 (= S410), K139 (= K425), Y165 (≠ F449), G166 (= G450), V168 (= V452), S171 (= S455), R172 (≠ S456)
- binding uridine-5'-diphosphate: K127 (= K413), N167 (= N451), V175 (= V459), P191 (≠ T474), I192 (≠ V475), T193 (= T476), M197 (≠ I480), R199 (= R482), M233 (≠ I517), R252 (= R550)
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
28% identity, 44% coverage: 279:564/655 of query aligns to 4:268/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K371), S176 (= S458), V177 (= V459), T195 (= T476), M199 (≠ I480), R201 (= R482), M235 (≠ I517), R254 (= R550), E257 (= E553)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G288), T15 (≠ G290), G16 (= G291), S17 (= S292), F18 (≠ I293), S39 (≠ A318), R40 (≠ L319), D41 (≠ Y320), K44 (≠ E323), D63 (≠ S345), V64 (= V346), A83 (= A367), A84 (= A368), A85 (= A369), K87 (= K371), L125 (≠ V409), S126 (= S410), Y137 (≠ M421), K141 (= K425), Y167 (≠ F449), G168 (= G450), V170 (= V452)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
28% identity, 44% coverage: 279:564/655 of query aligns to 4:268/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G288), T15 (≠ G290), G16 (= G291), S17 (= S292), F18 (≠ I293), R40 (≠ L319), D41 (≠ Y320), K44 (≠ E323), D63 (≠ S345), V64 (= V346), A83 (= A367), A84 (= A368), A85 (= A369), K87 (= K371), L125 (≠ V409), S126 (= S410), K141 (= K425), Y167 (≠ F449), G168 (= G450), V170 (= V452), R174 (≠ S456)
- binding uridine-5'-diphosphate-glucose: K87 (= K371), T127 (= T411), K129 (= K413), Y137 (≠ M421), N169 (= N451), S176 (= S458), V177 (= V459), P193 (≠ T474), T195 (= T476), M199 (≠ I480), R201 (= R482), M235 (≠ I517), R254 (= R550), E257 (= E553)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
28% identity, 44% coverage: 279:564/655 of query aligns to 4:268/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G288), T15 (≠ G290), G16 (= G291), S17 (= S292), F18 (≠ I293), R40 (≠ L319), D41 (≠ Y320), K44 (≠ E323), D63 (≠ S345), V64 (= V346), A84 (= A368), A85 (= A369), K87 (= K371), S126 (= S410), Y137 (≠ M421), K141 (= K425), Y167 (≠ F449), G168 (= G450), V170 (= V452), S173 (= S455), R174 (≠ S456)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K371), D128 (= D412), K129 (= K413), N169 (= N451), G175 (= G457), S176 (= S458), V177 (= V459), P193 (≠ T474), I194 (≠ V475), M199 (≠ I480), R201 (= R482), M235 (≠ I517), R254 (= R550), E257 (= E553)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
28% identity, 44% coverage: 279:564/655 of query aligns to 4:268/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G288), T15 (≠ G290), G16 (= G291), S17 (= S292), F18 (≠ I293), S39 (≠ A318), R40 (≠ L319), D41 (≠ Y320), K44 (≠ E323), D63 (≠ S345), V64 (= V346), A83 (= A367), A84 (= A368), A85 (= A369), K87 (= K371), T102 (≠ N386), L125 (≠ V409), S126 (= S410), T127 (= T411), Y137 (≠ M421), K141 (= K425), Y167 (≠ F449), G168 (= G450), V170 (= V452), S173 (= S455), R174 (≠ S456)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K371), T127 (= T411), D128 (= D412), K129 (= K413), Y137 (≠ M421), N169 (= N451), S176 (= S458), V177 (= V459), P193 (≠ T474), T195 (= T476), M199 (≠ I480), R201 (= R482), M235 (≠ I517), R254 (= R550), E257 (= E553)
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
29% identity, 41% coverage: 262:529/655 of query aligns to 5:277/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G291), S41 (= S292), I42 (= I293), D62 (= D313), I63 (= I314), D92 (vs. gap), I93 (≠ M343), L114 (≠ A367), S115 (≠ A368), A116 (= A369), K118 (= K371), V158 (= V409), D161 (= D412), K174 (= K425), V198 (= V452), S201 (= S455)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
31% identity, 35% coverage: 282:508/655 of query aligns to 4:198/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G288), T12 (≠ G290), G13 (= G291), S14 (= S292), F15 (≠ I293), S35 (≠ A318), R36 (≠ L319), D37 (≠ Y320), K40 (≠ E323), D59 (≠ S345), V60 (= V346), A80 (= A368), A81 (= A369), K83 (= K371), L121 (≠ V409), T123 (= T411), K137 (= K425), Y163 (≠ F449), G164 (= G450)
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
28% identity, 38% coverage: 262:507/655 of query aligns to 3:236/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: G38 (= G291), S39 (= S292), I40 (= I293), D60 (= D313), I61 (= I314), L89 (= L342), D90 (vs. gap), I91 (≠ M343), L112 (≠ A367), S113 (≠ A368), A114 (= A369), K116 (= K371), D159 (= D412), K172 (= K425), N195 (= N451), V196 (= V452), S199 (= S455)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
22% identity, 48% coverage: 277:592/655 of query aligns to 1:288/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G288), S14 (≠ G290), G15 (= G291), S16 (= S292), L17 (≠ I293), R36 (vs. gap), D37 (vs. gap), D59 (≠ S345), I60 (≠ V346), A81 (= A367), A82 (= A368), A83 (= A369), K85 (= K371), V128 (= V409), Y140 (≠ M421), K144 (= K425), Y168 (≠ F449), G169 (= G450), V171 (= V452)
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
23% identity, 39% coverage: 276:529/655 of query aligns to 3:272/667 of Q9LPG6
- G18 (= G291) mutation to A: Abolishes dehydratase activity.
- K36 (≠ R308) mutation to A: Reduces dehydratase activity.
- D96 (≠ P374) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K425) mutation to A: Abolishes dehydratase activity.
- G193 (= G454) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
20% identity, 38% coverage: 284:529/655 of query aligns to 3:256/309 of 4zrnA
- active site: T117 (= T411), G119 (≠ K413), A120 (= A414), Y143 (≠ M421), K147 (= K425), Y181 (vs. gap), G185 (≠ S458)
- binding nicotinamide-adenine-dinucleotide: G7 (= G288), G10 (= G291), F11 (≠ S292), I12 (= I293), D31 (≠ L312), N32 (≠ D313), S34 (= S315), S35 (≠ E316), G36 (≠ F317), S51 (= S345), I52 (≠ V346), L73 (≠ A367), A74 (= A368), A75 (= A369), T92 (≠ N386), S115 (≠ V409), S116 (= S410), Y143 (≠ M421), K147 (= K425), Y170 (≠ F449), V173 (= V452)
- binding uridine-5'-diphosphate-glucose: T117 (= T411), G119 (≠ K413), A120 (= A414), Y143 (≠ M421), N172 (= N451), G185 (≠ S458), V186 (= V459), H201 (≠ T474), F203 (vs. gap), Y208 (≠ I480), R210 (= R482), V244 (≠ I517)
Sites not aligning to the query:
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
22% identity, 38% coverage: 282:527/655 of query aligns to 7:268/669 of Q9SYM5
Sites not aligning to the query:
- 283 R→K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
Query Sequence
>WP_086511383.1 NCBI__GCF_002151265.1:WP_086511383.1
MRNLLQSLFRLPRRQKRTIQLMVDCVLIAASFLLAMLLRLESWTPLSEASTWLALLVLIP
LSLAIYVRLGFYRAVIRYLGPKAIRAVVVGVVVSALSLPLVSYLFALGIPRSVPFIYAML
ALLTIGGVRFGLRAIYLRSQIRHKPRVVIYGAGSAGRQLAASLTHGQEYLPIAFVDDALS
LQNTYIEGLKVYPPRQLGYLADTYGAERVLLAVPSASRARRREILAELEPQGFPVQTIPG
VVDMVTGRARISEVRDVAVEDLLGRDPVPPNPTLMDANIRGKVVLVTGAGGSIGSELCRQ
ILRHGPGRLLLLDISEFALYRIEQDLLRIAAEEGLEVRVEALMGSVQHRQRLTTVMKAYE
VQTVYHAAAYKHVPMVEHNVVEGVQNNVFGTLSAARSAIDAGVETFVLVSTDKAVRPTNV
MGTTKRLAELVCQAFARQQSATRFCMVRFGNVLGSSGSVVPLFRQQIQAGGPITVTHPDI
TRFFMTIPEAAQLVIQAGAMARGGDVFVLDMGEPVRIADLARQMVRLSGLKVRDERNPDG
DIAIAYSGLRPGEKLYEELLVGDDVAATSHPRIMTAQEVFWEWPRLENFLDRLFEACRNF
HHDGIRRLLLEAPTAYRPEGGIVDLVWLEKRRREALEPVSSAAVTPLRPVLERHK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory