SitesBLAST
Comparing WP_086511458.1 NCBI__GCF_002151265.1:WP_086511458.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7zlaB Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the half-closed conformation (see paper)
31% identity, 93% coverage: 35:511/515 of query aligns to 7:456/458 of 7zlaB
- binding : P9 (= P37), L10 (= L38), Y11 (≠ A39), S35 (= S63), K36 (≠ S64), R37 (= R65), K38 (≠ Q66), Q47 (≠ R75), Q47 (≠ R75), N48 (= N76), T49 (= T77), R68 (≠ G96)
Sites not aligning to the query:
7zn5B Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the closed conformation, c2 symmetry. (see paper)
30% identity, 93% coverage: 35:511/515 of query aligns to 4:433/435 of 7zn5B
- binding : P6 (= P37), S32 (= S63), R34 (= R65), K35 (≠ Q66), S43 (≠ G74), Q44 (≠ R75), N45 (= N76), E48 (≠ L79), R65 (≠ G96), K66 (≠ S97), R341 (= R419)
5t4kA Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
34% identity, 69% coverage: 145:501/515 of query aligns to 4:347/360 of 5t4kA
- binding (4S)-5-fluoro-4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: H8 (= H149), M9 (≠ A150), T75 (≠ A226), Y99 (= Y251), F144 (≠ Y297), D173 (= D325), Y175 (= Y327), T203 (= T355), S205 (= S357), R213 (= R365), R324 (≠ S477)
5t4jB Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
34% identity, 69% coverage: 145:501/515 of query aligns to 4:347/360 of 5t4jB
- binding gamma-amino-butanoic acid: H8 (= H149), M9 (≠ A150), Y99 (= Y251), Y175 (= Y327), R324 (≠ S477)
- binding pyridoxal-5'-phosphate: T75 (≠ A226), Y99 (= Y251), F144 (≠ Y297), D173 (= D325), Y175 (= Y327), T203 (= T355), S205 (= S357), R213 (= R365), S215 (≠ G367)
5x03B Crystal structure of thE C-terminal domain of bacillus subtilis gabr reveals a closed conformation by the binding of gamma-aminobutyric acid, inducing the transcriptional activation (see paper)
33% identity, 69% coverage: 145:501/515 of query aligns to 3:351/365 of 5x03B
6uxzB (S)-4-amino-5-phenoxypentanoate as a selective agonist of the transcription factor gabr (see paper)
33% identity, 69% coverage: 145:501/515 of query aligns to 3:346/358 of 6uxzB
- binding (4S)-4-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-5-phenoxypentanoic acid: H7 (= H149), M8 (≠ A150), G73 (= G225), T74 (≠ A226), Y98 (= Y251), R100 (≠ G253), F143 (≠ Y297), D172 (= D325), Y174 (= Y327), T202 (= T355), S204 (= S357), K205 (= K358), P209 (= P362), R212 (= R365), R323 (≠ S477)
7pq9AAA PLP-dependent aminotransferase family protein (see paper)
33% identity, 67% coverage: 167:511/515 of query aligns to 17:360/367 of 7pq9AAA
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
28% identity, 68% coverage: 157:508/515 of query aligns to 34:393/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G225), S103 (≠ A226), Q104 (= Q227), Y128 (= Y251), V177 (≠ T292), N182 (≠ Y297), D210 (= D325), P212 (≠ Y327), Y213 (≠ D328), T240 (= T355), S242 (= S357), K243 (= K358), R250 (= R365)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
28% identity, 68% coverage: 157:508/515 of query aligns to 37:395/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: G40 (= G160), L41 (≠ V161)
- binding 2-oxoglutaric acid: D213 (= D326), P214 (≠ Y327), Y215 (≠ D328), G216 (≠ S329), E217 (= E330), G241 (= G354), T242 (= T355), I246 (≠ V359)
- binding (2E)-pent-2-enedioic acid: G40 (= G160), Y130 (= Y251), N184 (≠ Y297), R376 (≠ V489)
- binding glutamic acid: L131 (≠ P252), V360 (≠ S473), A364 (≠ S477), R369 (≠ T482)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G225), S105 (≠ A226), Q106 (= Q227), Y130 (= Y251), N184 (≠ Y297), D212 (= D325), P214 (≠ Y327), Y215 (≠ D328), T242 (= T355), S244 (= S357), K245 (= K358), R252 (= R365)
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
28% identity, 68% coverage: 157:508/515 of query aligns to 37:395/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: L131 (≠ P252), Q135 (≠ A256), A364 (≠ S477), R369 (≠ T482)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: G40 (= G160), Y130 (= Y251), L131 (≠ P252), A132 (≠ G253), N184 (≠ Y297), R376 (≠ V489)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G225), S105 (≠ A226), Q106 (= Q227), Y130 (= Y251), V179 (≠ T292), N184 (≠ Y297), D212 (= D325), P214 (≠ Y327), Y215 (≠ D328), T242 (= T355), S244 (= S357), K245 (= K358), R252 (= R365)
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
28% identity, 68% coverage: 157:508/515 of query aligns to 37:395/404 of 3aowC
- binding 2-oxoglutaric acid: Y70 (= Y190), Y130 (= Y251), L275 (≠ R388)
- binding pyridoxal-5'-phosphate: G104 (= G225), S105 (≠ A226), Q106 (= Q227), Y130 (= Y251), V179 (≠ T292), N184 (≠ Y297), D212 (= D325), P214 (≠ Y327), Y215 (≠ D328), T242 (= T355), S244 (= S357), K245 (= K358), R252 (= R365)
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
28% identity, 68% coverage: 157:508/515 of query aligns to 37:395/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G225), S105 (≠ A226), Q106 (= Q227), Y130 (= Y251), V179 (≠ T292), N184 (≠ Y297), D212 (= D325), P214 (≠ Y327), Y215 (≠ D328), T242 (= T355), S244 (= S357), K245 (= K358), R252 (= R365)
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
27% identity, 73% coverage: 134:511/515 of query aligns to 26:401/405 of 2zc0A
- active site: Y132 (= Y251), D214 (= D325), A216 (≠ Y327), S246 (= S357)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G225), G107 (≠ A226), T108 (≠ Q227), Y132 (= Y251), N186 (≠ Y297), D214 (= D325), A216 (≠ Y327), Y217 (≠ D328), T244 (= T355), S246 (= S357), K247 (= K358), R254 (= R365)
8tn3A Structure of s. Hygroscopicus aminotransferase mppq complexed with pyridoxamine 5'-phosphate (pmp) (see paper)
32% identity, 58% coverage: 215:511/515 of query aligns to 82:387/388 of 8tn3A
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
30% identity, 65% coverage: 157:493/515 of query aligns to 33:368/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: G35 (≠ P159), G36 (= G160), G95 (= G225), S96 (≠ A226), Q97 (= Q227), Y121 (= Y251), N170 (≠ Y297), D198 (= D325), Y201 (≠ D328), S231 (≠ T355), S233 (= S357), K234 (= K358), R241 (= R365), R364 (≠ V489)
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
30% identity, 65% coverage: 157:493/515 of query aligns to 33:368/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G225), S96 (≠ A226), Q97 (= Q227), Y121 (= Y251), N170 (≠ Y297), D198 (= D325), A200 (≠ Y327), Y201 (≠ D328), S231 (≠ T355), S233 (= S357), K234 (= K358), R241 (= R365)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
30% identity, 65% coverage: 157:493/515 of query aligns to 29:364/389 of 2z1yA
- binding leucine: G32 (= G160), Y117 (= Y251), R360 (≠ V489)
- binding pyridoxal-5'-phosphate: G91 (= G225), S92 (≠ A226), Q93 (= Q227), Y117 (= Y251), N166 (≠ Y297), D194 (= D325), Y197 (≠ D328), S227 (≠ T355), S229 (= S357), K230 (= K358), R237 (= R365)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
30% identity, 65% coverage: 157:493/515 of query aligns to 37:372/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: G39 (≠ P159), G40 (= G160), G99 (= G225), S100 (≠ A226), Q101 (= Q227), Y125 (= Y251), N174 (≠ Y297), D202 (= D325), Y205 (≠ D328), S235 (≠ T355), S237 (= S357), K238 (= K358), R245 (= R365), R368 (≠ V489)
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
30% identity, 65% coverage: 157:493/515 of query aligns to 37:372/397 of Q72LL6
- G40 (= G160) binding
- Y70 (= Y190) binding
- N174 (≠ Y297) binding ; binding
- R245 (= R365) binding
- R368 (≠ V489) binding
Sites not aligning to the query:
- 20 S→E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- 23 R→A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; R→Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
25% identity, 57% coverage: 160:452/515 of query aligns to 46:349/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G225), S113 (≠ A226), Q114 (= Q227), Y138 (= Y251), N194 (≠ Y297), D222 (= D325), P224 (≠ Y327), Y225 (≠ D328), T252 (= T355), S254 (= S357), K255 (= K358), R262 (= R365)
Query Sequence
>WP_086511458.1 NCBI__GCF_002151265.1:WP_086511458.1
MNGIADRGLSSTSAGIGQTDWLADALGLALAEGSPQPLATRLYHQLREWIQAGRLVCGQR
LPSSRQLARELGLGRNTVLAAFDQLLAEGFLVARHGSGTFVADLAFPCTTQPTTQPALAV
GLTTSHTLPARADAPSLSSRGTSLLAFCHASQERPILAPGVPALDRFPHGPWQRLVRRHQ
QRMPREWLAYQAQGGVPTLREALADYLQLSRSVRCRPEQILIVQGAQQGFELIARLLSDP
GDKVWIEEPGYPGAQACFAAAGLDLQAVPVDDEGLSVAAAANAESPRLIYVTPSHQYPSG
VTMSLSRRLALLEAAERHGAWIVEDDYDSEFRYGQRPIAALQGLVDDSRVIYVGTFSKVM
YPGLRLGYVVLPEPLVEPFRRANARLHREGQYPVQAALAEFIVGGQFSRHIRRMRDCYRR
RQALLRKALAPAVARGLRLSDGQAGMHLVAWLDEAEQERELLRRGAAQGLSLSPLSSYYL
ETPARPGLVLGYAGTVEAELERAGRWLAREWLSLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory