SitesBLAST
Comparing WP_086511466.1 NCBI__GCF_002151265.1:WP_086511466.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
73% identity, 96% coverage: 12:394/401 of query aligns to 1:383/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H92), K82 (= K93), Q109 (≠ M120), S185 (≠ T196), G227 (= G238), G229 (= G240), S230 (= S241), N231 (= N242), E345 (= E356), S371 (= S382), G372 (= G383)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
63% identity, 94% coverage: 14:389/401 of query aligns to 3:378/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
63% identity, 94% coverage: 14:389/401 of query aligns to 3:378/386 of 1v8zA
- active site: K82 (= K93), E104 (= E115), S371 (= S382)
- binding pyridoxal-5'-phosphate: H81 (= H92), K82 (= K93), Q109 (≠ M120), S185 (≠ T196), G227 (= G238), G228 (= G239), G229 (= G240), S230 (= S241), N231 (= N242), E345 (= E356), S371 (= S382), G372 (= G383)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
63% identity, 94% coverage: 14:389/401 of query aligns to 3:378/388 of 5dw0A
- active site: K82 (= K93), E104 (= E115), S371 (= S382)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H92), K82 (= K93), T105 (= T116), G106 (= G117), A107 (= A118), Q109 (≠ M120), H110 (= H121), S185 (≠ T196), G227 (= G238), G229 (= G240), S230 (= S241), N231 (= N242), G298 (= G309), D300 (= D311), E345 (= E356), S371 (= S382)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
63% identity, 94% coverage: 14:389/401 of query aligns to 3:378/385 of 6am8B
- active site: K82 (= K93), E104 (= E115), S371 (= S382)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H92), K82 (= K93), E104 (= E115), T105 (= T116), G106 (= G117), A107 (= A118), Q109 (≠ M120), H110 (= H121), L161 (= L172), S185 (≠ T196), V187 (≠ A198), G227 (= G238), G228 (= G239), G229 (= G240), S230 (= S241), N231 (= N242), G298 (= G309), Y301 (= Y312), E345 (= E356), S371 (= S382), G372 (= G383)
- binding tryptophan: P12 (= P23), L169 (= L180), S274 (≠ L285), H275 (= H286)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
63% identity, 94% coverage: 14:389/401 of query aligns to 3:378/384 of 7rnpA
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
63% identity, 94% coverage: 14:389/401 of query aligns to 3:377/383 of 5dw3A
- active site: K82 (= K93), E104 (= E115), S370 (= S382)
- binding tryptophan: K82 (= K93), E104 (= E115), T105 (= T116), G106 (= G117), A107 (= A118), Q109 (≠ M120), H110 (= H121), S185 (≠ T196), G228 (= G239), Y300 (= Y312)
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
63% identity, 94% coverage: 14:389/401 of query aligns to 3:378/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H92), K82 (= K93), T105 (= T116), G106 (= G117), A107 (= A118), Q109 (≠ M120), H110 (= H121), S185 (≠ T196), G227 (= G238), G229 (= G240), S230 (= S241), N231 (= N242), G298 (= G309), E345 (= E356), S371 (= S382)
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
63% identity, 94% coverage: 14:389/401 of query aligns to 3:378/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H92), K82 (= K93), T105 (= T116), G106 (= G117), A107 (= A118), Q109 (≠ M120), H110 (= H121), S185 (≠ T196), G227 (= G238), G229 (= G240), S230 (= S241), N231 (= N242), G298 (= G309), E345 (= E356), S371 (= S382)
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
63% identity, 94% coverage: 14:389/401 of query aligns to 3:376/394 of 5ixjD
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
63% identity, 94% coverage: 14:389/401 of query aligns to 3:376/383 of 5t6mA
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
61% identity, 98% coverage: 5:397/401 of query aligns to 7:402/406 of 5tciH
- active site: K98 (= K93), E120 (= E115), S387 (= S382)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (= P23), L31 (= L26), Y197 (= Y192), F199 (≠ I194), P205 (= P200), F208 (≠ Y203), H291 (= H286)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
61% identity, 98% coverage: 5:397/401 of query aligns to 6:401/405 of 6uapB
- active site: K97 (= K93), E119 (= E115), S386 (= S382)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (≠ M176), N181 (= N177), F184 (≠ L180), Y196 (= Y192), F198 (≠ I194), P204 (= P200), F207 (≠ Y203), H290 (= H286)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
61% identity, 98% coverage: 5:397/401 of query aligns to 6:401/404 of 6usaB
- active site: K97 (= K93), E119 (= E115), S386 (= S382)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H92), K97 (= K93), T120 (= T116), G121 (= G117), A122 (= A118), G123 (= G119), Q124 (≠ M120), H125 (= H121), T200 (= T196), G242 (= G238), G244 (= G240), S245 (= S241), N246 (= N242), G313 (= G309), E360 (= E356), S386 (= S382)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ L180), W187 (= W183), Y196 (= Y192), F198 (≠ I194), G203 (= G199), P204 (= P200), F207 (≠ Y203), H290 (= H286), G291 (= G287)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
61% identity, 98% coverage: 5:397/401 of query aligns to 6:401/404 of 6dweB
- active site: K97 (= K93), E119 (= E115), S386 (= S382)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ L180), Y196 (= Y192), F198 (≠ I194), P204 (= P200), F207 (≠ Y203), H290 (= H286)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H92), K97 (= K93), T120 (= T116), G121 (= G117), A122 (= A118), G123 (= G119), Q124 (≠ M120), H125 (= H121), T200 (= T196), G242 (= G238), G244 (= G240), S245 (= S241), N246 (= N242), G313 (= G309), E360 (= E356), S386 (= S382)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
61% identity, 98% coverage: 5:397/401 of query aligns to 7:402/405 of 6u6cB
- active site: K98 (= K93), E120 (= E115), S387 (= S382)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H92), K98 (= K93), T121 (= T116), G122 (= G117), A123 (= A118), Q125 (≠ M120), H126 (= H121), T201 (= T196), G243 (= G238), G245 (= G240), S246 (= S241), N247 (= N242), G314 (= G309), E361 (= E356), S387 (= S382)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (≠ F21), F185 (≠ L180), W188 (= W183), Y197 (= Y192), F199 (≠ I194), G204 (= G199), P205 (= P200), H291 (= H286), G292 (= G287)
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
61% identity, 98% coverage: 5:397/401 of query aligns to 2:397/399 of 5ocwB
- active site: K93 (= K93), E115 (= E115), S382 (= S382)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H92), K93 (= K93), T116 (= T116), G117 (= G117), A118 (= A118), Q120 (≠ M120), H121 (= H121), T196 (= T196), G238 (= G238), G240 (= G240), S241 (= S241), N242 (= N242), G309 (= G309), E356 (= E356), S382 (= S382)
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
63% identity, 94% coverage: 14:389/401 of query aligns to 3:376/383 of 5vm5D
- active site: K82 (= K93), E104 (= E115), S369 (= S382)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H92), K82 (= K93), T105 (= T116), G106 (= G117), A107 (= A118), Q109 (≠ M120), H110 (= H121), S185 (≠ T196), G227 (= G238), G229 (= G240), S230 (= S241), N231 (= N242), G296 (= G309), E343 (= E356), S369 (= S382)
8egzB Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate
61% identity, 96% coverage: 12:395/401 of query aligns to 2:380/386 of 8egzB
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H92), K82 (= K93), T105 (= T116), G106 (= G117), A107 (= A118), Q109 (≠ M120), H110 (= H121), S185 (≠ T196), G229 (= G240), S230 (= S241), N231 (= N242), G297 (= G309), E344 (= E356), S367 (= S382)
8eh1A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with 4-hydroxyquinoline
61% identity, 96% coverage: 12:395/401 of query aligns to 1:379/383 of 8eh1A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H92), K81 (= K93), T104 (= T116), G105 (= G117), A106 (= A118), Q108 (≠ M120), H109 (= H121), S184 (≠ T196), G228 (= G240), S229 (= S241), N230 (= N242), G296 (= G309), E343 (= E356), S366 (= S382)
- binding quinolin-4-ol: G103 (≠ E115), L160 (= L172), I164 (≠ M176), G183 (= G195), S184 (≠ T196), Y299 (= Y312)
Query Sequence
>WP_086511466.1 NCBI__GCF_002151265.1:WP_086511466.1
MTDLSMQPDAHGMFGRFGGRFVPETLMPLITELQSEYDAARQDTEFQRQLAYFQRDYVGR
PSPLYFAERLTEHFGGARIYLKREELNHTGAHKINNCIGQILLAKRMGKTRIIAETGAGM
HGVATATVAARFGMPCVVYMGSADIERQQPNVFRMKLLGAEVIPVTTGTGTLKDAMNEAL
RDWVTNVEDTFYIIGTVAGPHPYPAMVRDFQAVIGRETRTQILEKEGRLPDSLVACIGGG
SNAMGLFHPFLADETVQMIGVEAGGKGVDTGLHAASLTGGEPGVLHGNRTYLLQDEDGQI
IDAHSISAGLDYPGIGPEHAWLHERGRVEYVSITDDEALAAFQCCCRLEGIIPALESAHA
LAEVAKRAPSLPRDHLMVVNLSGRGDKDMMSVAQHLGENVQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory