SitesBLAST
Comparing WP_086511549.1 NCBI__GCF_002151265.1:WP_086511549.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
38% identity, 94% coverage: 15:248/248 of query aligns to 6:240/240 of 1ji0A
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 91% coverage: 14:239/248 of query aligns to 1:228/241 of 4u00A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 94% coverage: 15:246/248 of query aligns to 2:235/240 of 6mjpA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 90% coverage: 24:246/248 of query aligns to 13:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 90% coverage: 24:246/248 of query aligns to 13:253/254 of 1g6hA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 93% coverage: 16:246/248 of query aligns to 3:235/235 of 6mhzA
- binding adp orthovanadate: Y12 (= Y25), N37 (= N50), G38 (= G51), G40 (= G53), K41 (= K54), T42 (= T55), T43 (= T56), Q84 (≠ E97), S136 (≠ F147), S138 (= S149), G139 (= G150), G140 (= G151), E162 (= E173), G166 (= G177), H194 (≠ K205)
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 93% coverage: 16:246/248 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 93% coverage: 16:246/248 of query aligns to 3:235/238 of 6s8gA
- binding phosphoaminophosphonic acid-adenylate ester: Y12 (= Y25), R15 (≠ S28), N37 (= N50), G40 (= G53), K41 (= K54), T42 (= T55), T43 (= T56), Q84 (≠ E97), S136 (≠ F147), S138 (= S149), E141 (= E152)
6mbnA Lptb e163q in complex with atp (see paper)
29% identity, 93% coverage: 16:246/248 of query aligns to 4:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
29% identity, 93% coverage: 16:245/248 of query aligns to 3:234/234 of 6b89A
- binding adenosine-5'-diphosphate: Y12 (= Y25), R15 (≠ S28), V17 (= V30), N37 (= N50), G38 (= G51), G40 (= G53), K41 (= K54), T42 (= T55), T43 (= T56)
- binding magnesium ion: T42 (= T55), Q84 (≠ E97)
- binding novobiocin: L71 (≠ P84), H72 (≠ W85), P83 (= P96), A86 (≠ R99), S87 (≠ G100), F89 (= F102), R90 (≠ P103), R91 (≠ G104), L92 (≠ I105), V101 (≠ A114), Q135 (≠ S146), R149 (= R160)
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
29% identity, 93% coverage: 16:245/248 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
29% identity, 91% coverage: 16:240/248 of query aligns to 3:229/233 of 6b8bA
- binding adenosine-5'-diphosphate: Y12 (= Y25), R15 (≠ S28), V17 (= V30), G38 (= G51), G40 (= G53), K41 (= K54), T42 (= T55), T43 (= T56)
- binding (3s,5s,7s)-N-{7-[(3-O-carbamoyl-6-deoxy-5-methyl-4-O-methyl-beta-D-gulopyranosyl)oxy]-4-hydroxy-8-methyl-2-oxo-2H-1-benzopyran-3-yl}tricyclo[3.3.1.1~3,7~]decane-1-carboxamide: F89 (= F102), R90 (≠ P103), R91 (≠ G104)
7t55A Cryo-em structure of pcat1 in the inward-facing wide conformation under atp turnover condition (see paper)
32% identity, 86% coverage: 16:229/248 of query aligns to 479:695/715 of 7t55A
Sites not aligning to the query:
- binding : 14, 46, 47, 48, 52, 63, 64, 65, 66, 75, 83, 91, 93
Q99758 Phospholipid-transporting ATPase ABCA3; ABC-C transporter; ATP-binding cassette sub-family A member 3; ATP-binding cassette transporter 3; ATP-binding cassette 3; Xenobiotic-transporting ATPase ABCA3; EC 7.6.2.1; EC 7.6.2.2 from Homo sapiens (Human) (see 15 papers)
31% identity, 82% coverage: 34:236/248 of query aligns to 552:752/1704 of Q99758
- N568 (= N50) to D: in SMDP3; does not affect location in intracellular vesicle membrane; does not affect proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; decreases ATP binding in vitro; does not affect protein expression; does not affect multivesicular bodies and lamellar bodies location; affects multivesicular bodies and lamellar bodies development; loss of phosphatidylcholine transport; does not affect cholesterol transport; dbSNP:rs121909184
- L579 (≠ I61) to P: in SMDP3; uncertain significance
- R605 (= R89) to Q: in SMDP3; uncertain significance; dbSNP:rs760006956
- S693 (≠ E176) mutation to L: Does not affect protein oligomerization.
Sites not aligning to the query:
- 43 R → L: in SMDP3; uncertain significance
- 53 N→Q: Does not affect N-glycosylation. Does not affect protein expression. Does not affect lamellar body membrane location.
- 101 L → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; decreases ATP binding in vitro; dbSNP:rs121909182
- 124 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Loss of N-glycosylation. Reduces protein expression by 50%. Affects anterograde trafficking; when associated with Q-140. Reduces protein expression by 85%; when associated with Q-140. Does not affect lamellar body membrane location.
- 140 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N → H: in dbSNP:rs45447801; N→Q: Loss of N-glycosylation. Reduces protein expression by 50%. Affects anterograde trafficking; when associated with Q-124. Reduces protein expression by 85%; when associated with Q-140. Does not affect lamellar body membrane location.
- 173:174 LK→AA: Loss of proteolytic processing.
- 174:175 Cleavage; by CTSL
- 215 Q → K: in SMDP3; loss of lamellar bodies membrane location; loss of proteolytic cleavage; increases cellular free cholesterol and phosphatidylcholine transport; loss of vesicles formation; increases free cholesterol induced cell death; loss of protein oligomerization; dbSNP:rs879159551
- 280 R → C: in SMDP3; uncertain significance; does not affect protein oligomerization; dbSNP:rs201299260
- 288 R → K: in SMDP3; uncertain significance; does not affect protein oligomerization; dbSNP:rs117603931
- 290 L → M: in a breast cancer sample; somatic mutation
- 292 E → V: in SMDP3; uncertain significance; does not affect lamellar bodies membrane location; does not affect proteolytic cleavage; affects lamellar bodies formation; does not affect cholesterol and phosphatidylcholine transport; decreases vesicles formation; does not affect free cholesterol induced cell death; dbSNP:rs149989682
- 766 P → S: in dbSNP:rs45592239
- 801 E → D: in a breast cancer sample; somatic mutation
- 945 N→Q: Does not affect lamellar body membrane location. Does not affect protein expression. Does not affect proteolytic processing.
- 982 L → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; dbSNP:rs1402761450
- 1069 H → Q: in a breast cancer sample; somatic mutation
- 1076 N → K: in SMDP3; uncertain significance
- 1221 G → S: in SMDP3; does not affect intracellular vesicle membrane location; does not affect proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; G→A: Decreases ATP hydrolysis activity of 15% compared to the wild-type.; G→T: Decreases ATP hydrolysis activity of 36% compared to the wild-type.; G→V: Decreases ATP hydrolysis activity of 18% compared to the wild-type.
- 1302 G → E: in SMDP3; uncertain significance
- 1388 K → N: in SMDP3; decreases phosphatidylcholine transport; increases protein abundance; does not affect folding in the endoplasmic reticulum; decreases proteolytic processing; affects lamellar bodies development; reduces free cholesterol transport
- 1553 L → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; dbSNP:rs121909183
- 1580 L → P: in SMDP3; does not affect location in intracellular vesicle membrane; does not affect proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; decreases ATP binding in vitro; affects the intracellular vesicles development; decreases phosphatidylcholine transport; L→A: Decreases ATP hydrolysis activity of 13% compared to the wild-type.; L→F: Decreases ATP hydrolysis activity of 13% compared to the wild-type.; L→V: Decreases ATP hydrolysis activity of 56% compared to the wild-type.
- 1591 Q → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; dbSNP:rs28936691
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 87% coverage: 15:229/248 of query aligns to 1:218/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (≠ Y25), V16 (= V30), S36 (≠ N50), G37 (= G51), S38 (≠ M52), G39 (= G53), K40 (= K54), S41 (≠ T55), T42 (= T56), E162 (= E173), H194 (≠ K205)
- binding magnesium ion: S41 (≠ T55), E162 (= E173)
4s0fA Crystal structure of the peptidase-containing abc transporter pcat1 e648q mutant complexed with atpgs in an occluded conformation (see paper)
32% identity, 86% coverage: 16:229/248 of query aligns to 329:545/565 of 4s0fA
7w02A Cryo-em structure of atp-bound abca3 (see paper)
31% identity, 82% coverage: 34:236/248 of query aligns to 517:717/1566 of 7w02A
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 504, 1277, 1305, 1306, 1307, 1308, 1309, 1310, 1344, 1395, 1398
- binding magnesium ion: 1310, 1344
7roqA Alternative structure of human abca1
31% identity, 82% coverage: 33:235/248 of query aligns to 789:989/1831 of 7roqA
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
31% identity, 95% coverage: 14:248/248 of query aligns to 2:245/250 of 7z18I
- binding adenosine-5'-triphosphate: Y13 (= Y25), S38 (≠ N50), G39 (= G51), S40 (≠ M52), G41 (= G53), K42 (= K54), T43 (= T55), T44 (= T56), Q88 (≠ E97), R136 (= R140), T143 (≠ F147), S145 (= S149), G147 (= G151), M148 (≠ E152), H202 (≠ K205)
- binding magnesium ion: T43 (= T55), Q88 (≠ E97)
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
31% identity, 95% coverage: 14:248/248 of query aligns to 2:245/253 of 7z15I
- binding adenosine-5'-diphosphate: Y13 (= Y25), K17 (≠ H29), G18 (≠ V30), S38 (≠ N50), G39 (= G51), G41 (= G53), K42 (= K54), T43 (= T55), T44 (= T56), R136 (= R140), T143 (≠ F147), S145 (= S149), M148 (≠ E152)
- binding magnesium ion: T43 (= T55), Q88 (≠ E97)
Query Sequence
>WP_086511549.1 NCBI__GCF_002151265.1:WP_086511549.1
MTNPRASASGASAPLIDARGLHTYYGESHVLHGVDLRLMPGETLSLMGRNGMGKTTTLKS
ILGFVPPREGEVSIKGKSTARRRPWQLIRQGIGYVPEGRGIFPGISVREHLIMAARPNER
GESPWTLERVLDTFPRLGQRINHDGSFLSGGEQQMLSIGRALTTNPDMVILDEATEGLAP
LIRDEIWKIIREIKASGIASIIVDKNIDNLLEVADKHLLLVKGEVVYSGDSQGLREDPSI
LDTHLGVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory