SitesBLAST
Comparing WP_086511672.1 NCBI__GCF_002151265.1:WP_086511672.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 88% coverage: 5:506/570 of query aligns to 63:581/629 of Q9SS48
- S86 (≠ A28) mutation to F: In spd6-2; loss of 90% of activity.
- E546 (≠ R471) mutation to G: In spd6-1; loss of 90% of activity.
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
28% identity, 86% coverage: 4:494/570 of query aligns to 7:504/557 of 2rgoA
- binding flavin-adenine dinucleotide: G25 (= G22), I28 (= I25), T29 (≠ N26), E48 (= E45), M49 (≠ R46), Q50 (≠ G47), T56 (= T53), S57 (= S54), A197 (≠ S191), S232 (≠ A225), G233 (= G226), W235 (= W228), G257 (= G249), G344 (= G332), L345 (≠ V333), Y357 (≠ R346), K382 (= K372), I383 (≠ L373), T384 (= T374)
2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
29% identity, 87% coverage: 14:507/570 of query aligns to 2:484/495 of 2r46A
- binding flavin-adenine dinucleotide: I9 (≠ V21), G12 (= G24), I13 (= I25), N14 (= N26), L32 (≠ I44), E33 (= E45), A34 (≠ R46), T41 (= T53), S42 (= S54), A44 (≠ H56), S45 (= S57), S46 (= S58), L48 (= L60), A172 (≠ S191), T206 (≠ A225), G231 (= G249), R317 (= R334), G353 (= G371), K354 (= K372), L355 (= L373), T356 (= T374)
- binding phosphoenolpyruvate: R54 (≠ K66), Y55 (= Y67), R254 (= R272), T270 (= T287), D272 (= D289), R317 (= R334), R332 (= R353)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (≠ R176), V455 (≠ K478), D456 (≠ R479), H457 (≠ R480), W459 (≠ M482)
2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
29% identity, 87% coverage: 14:507/570 of query aligns to 2:484/495 of 2r45A
- binding 2-phosphoglyceric acid: R54 (≠ K66), Y55 (= Y67), R254 (= R272), I255 (≠ L273), T270 (= T287), R317 (= R334), R332 (= R353)
- binding flavin-adenine dinucleotide: I9 (≠ V21), G12 (= G24), I13 (= I25), N14 (= N26), E33 (= E45), A34 (≠ R46), C39 (≠ G51), A40 (≠ S52), T41 (= T53), S42 (= S54), A44 (≠ H56), S45 (= S57), S46 (= S58), L48 (= L60), A172 (≠ S191), T206 (≠ A225), G207 (= G226), W209 (= W228), G231 (= G249), R317 (= R334), G353 (= G371), K354 (= K372), L355 (= L373), T356 (= T374)
- binding phosphate ion: Q212 (≠ E231), G277 (vs. gap), P279 (= P295), V310 (≠ I327), Y398 (≠ L425), R401 (≠ Q428), R405 (vs. gap), R462 (= R485), D464 (≠ E487), W468 (≠ R491)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (≠ R176), V160 (≠ L179), V455 (≠ K478), D456 (≠ R479), H457 (≠ R480), W459 (≠ M482)
2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
29% identity, 87% coverage: 14:507/570 of query aligns to 2:484/501 of 2qcuB
- binding flavin-adenine dinucleotide: I9 (≠ V21), G12 (= G24), I13 (= I25), N14 (= N26), E33 (= E45), A34 (≠ R46), C39 (≠ G51), T41 (= T53), S42 (= S54), S45 (= S57), S46 (= S58), L48 (= L60), H50 (≠ W62), A172 (≠ S191), T206 (≠ A225), W209 (= W228), G231 (= G249), R317 (= R334), G353 (= G371), K354 (= K372), L355 (= L373), T356 (= T374)
- binding phosphate ion: R54 (≠ K66), Y55 (= Y67), R317 (= R334), R332 (= R353)
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
28% identity, 62% coverage: 38:390/570 of query aligns to 39:392/530 of 2rgoB
- binding flavin-adenine dinucleotide: E46 (= E45), M47 (≠ R46), Q48 (≠ G47), T54 (= T53), S55 (= S54), S58 (= S57), T59 (≠ S58), A193 (≠ S191), S227 (≠ A225), G228 (= G226), W230 (= W228), L338 (≠ V333), R339 (= R334), Y350 (vs. gap), K374 (= K372), I375 (≠ L373), T376 (= T374)
Sites not aligning to the query:
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
27% identity, 63% coverage: 37:397/570 of query aligns to 40:344/496 of 3da1A
- binding flavin-adenine dinucleotide: E48 (= E45), M49 (≠ R46), G55 (≠ S52), S57 (= S54), S60 (= S57), T61 (≠ S58), L63 (= L60), H65 (≠ W62), V151 (≠ S191), G187 (= G226), W189 (= W228), L193 (≠ H232), G210 (= G249), T250 (= T287), G296 (= G332), R298 (= R334), G319 (= G371), K320 (= K372), L321 (= L373)
Sites not aligning to the query:
7koeC Electron bifurcating flavoprotein fix/etfabcx (see paper)
42% identity, 9% coverage: 16:68/570 of query aligns to 5:51/438 of 7koeC
- active site: M45 (≠ W62)
- binding flavin-adenine dinucleotide: V10 (= V21), G11 (= G22), G13 (= G24), P14 (≠ I25), S15 (≠ N26), V33 (≠ I44), E34 (= E45), K35 (≠ R46), K42 (≠ T53), N43 (≠ S54), M45 (≠ W62), G46 (= G63), V48 (≠ I65)
Sites not aligning to the query:
- active site: 287, 323
- binding flavin-adenine dinucleotide: 109, 133, 165, 166, 190, 231, 310, 320, 321, 322, 323
- binding menaquinone-7: 78, 80, 82, 91, 318, 319, 395, 398, 399, 433
Query Sequence
>WP_086511672.1 NCBI__GCF_002151265.1:WP_086511672.1
MELRSSNIDKLGGEVFDVLIVGGGINGASAAAALAGKGVRVALIERGDFAGSTSMHSSNL
VWGGIKYMESRDFALVRKLCRSRNHLIKSYPSTVQEIRFLTTITRGFRYHPRYLWAGAWL
YWLIGNGFTRIPRFLSPQAISDNEAIIDTSSAVGGFEYSDAYLHDNDARFVFNFVRGALN
YGAVAVNYVESLGARRESDGWLTRVRDVMSGRELEVRSRVLINAAGPWVDEHNALTGQST
NHRHVYSKGIHLIVPRLTDSQRVLAFFADDGRLFFVIPMGPRTCIGTTDTRVERPEVVAT
QEDIRFVLDNINKRLRLERPLDQQDIISIRCGVRPLAVKATGGGERDFLQLSRKHAIDIN
SHDAHLSIFGGKLTDCLNVGEEVVEAVNRMGIEVPFPKHRWYGEPPDQVRREFLHQARLM
RLDDLTAQASSEPLSTRLWRRYGTHALEMLEEIREDPRQAEVLIEGTEYLRCELHYAKRR
EMITRLEDFLRRRSKIALVVHEEAMRRSPGLREACTILFGEEADARLEEYFATTRRERSE
AAAVERAATVASASAALAEPGAEPGRQASH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory