SitesBLAST
Comparing WP_086511801.1 NCBI__GCF_002151265.1:WP_086511801.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7L5Y1 Mitochondrial enolase superfamily member 1; Antisense RNA to thymidylate synthase; rTS; L-fuconate dehydratase; EC 4.2.1.68 from Homo sapiens (Human) (see 5 papers)
60% identity, 99% coverage: 4:432/434 of query aligns to 6:435/443 of Q7L5Y1
- M145 (≠ Q144) to T: in dbSNP:rs2612086
- S148 (≠ R147) modified: Phosphoserine
- D250 (= D249) binding
- E276 (= E275) binding
- E305 (= E302) binding
Sites not aligning to the query:
- 1:27 mutation Missing: Impairs protein solubility. Abolishes catalytic activity.
4a35A Crystal structure of human mitochondrial enolase superfamily member 1 (enosf1) (see paper)
60% identity, 99% coverage: 4:432/434 of query aligns to 7:436/441 of 4a35A
- active site: K221 (= K219), K223 (= K221), D251 (= D249), N253 (= N251), E277 (= E275), E306 (= E302), D329 (= D325), H356 (= H352), S380 (= S376), E387 (= E383)
- binding magnesium ion: Y188 (= Y186), D251 (= D249), E277 (= E275), E306 (= E302), Y374 (= Y370)
4ip5A Crystal structure of l-fuconate dehydratase from silicibacter sp. Tm1040 liganded with mg and d-erythronohydroxamate
59% identity, 98% coverage: 2:425/434 of query aligns to 1:421/421 of 4ip5A
- active site: K217 (= K221), D245 (= D249), N247 (= N251), E271 (= E275), E298 (= E302), D321 (= D325), H348 (= H352), E379 (= E383)
- binding (2r,3r)-n,2,3,4-tetrahydroxybutanamide: G21 (= G22), D23 (= D24), Y31 (= Y32), K215 (= K219), K217 (= K221), D245 (= D249), N247 (= N251), E298 (= E302), H348 (= H352)
- binding magnesium ion: D245 (= D249), E271 (= E275), E298 (= E302)
4ip4A Crystal structure of l-fuconate dehydratase from silicibacter sp. Tm1040 liganded with mg
59% identity, 98% coverage: 2:425/434 of query aligns to 1:421/421 of 4ip4A
Q8P3K2 L-fuconate dehydratase; FucD; EC 4.2.1.68 from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
57% identity, 99% coverage: 1:431/434 of query aligns to 1:430/441 of Q8P3K2
- GSD 22:24 (= GSD 22:24) binding
- Y32 (= Y32) binding
- K218 (= K219) binding
- K220 (= K221) mutation to A: Inactive.
- D248 (= D249) binding
- N250 (= N251) binding
- E274 (= E275) binding ; binding
- E301 (= E302) binding ; binding
- HAG 351:353 (= HAG 352:354) binding
- E382 (= E383) binding
1yeyC Crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. Campestris str. Atcc 33913
57% identity, 99% coverage: 1:431/434 of query aligns to 1:430/435 of 1yeyC
- active site: T55 (= T55), T190 (= T191), K218 (= K219), K220 (= K221), D248 (= D249), N250 (= N251), E274 (= E275), G300 (= G301), E301 (= E302), D324 (= D325), P350 (= P351), H351 (= H352), A352 (= A353), D368 (= D369), K375 (≠ S376), E382 (= E383)
- binding magnesium ion: D248 (= D249), E274 (= E275), E301 (= E302)
2hxtA Crystal structure of l-fuconate dehydratase from xanthomonas campestris liganded with mg++ and d-erythronohydroxamate (see paper)
57% identity, 99% coverage: 3:431/434 of query aligns to 2:429/434 of 2hxtA
- active site: T54 (= T55), T189 (= T191), K217 (= K219), K219 (= K221), D247 (= D249), N249 (= N251), E273 (= E275), G299 (= G301), E300 (= E302), D323 (= D325), P349 (= P351), H350 (= H352), A351 (= A353), D367 (= D369), K374 (≠ S376), E381 (= E383)
- binding (2r,3r)-n,2,3,4-tetrahydroxybutanamide: G21 (= G22), D23 (= D24), Y31 (= Y32), K217 (= K219), K219 (= K221), E300 (= E302), H350 (= H352), G352 (= G354), E381 (= E383)
- binding magnesium ion: D247 (= D249), E273 (= E275), E300 (= E302)
2hxuA Crystal structure of k220a mutant of l-fuconate dehydratase from xanthomonas campestris liganded with mg++ and l-fuconate (see paper)
56% identity, 99% coverage: 3:431/434 of query aligns to 2:429/434 of 2hxuA
- active site: T54 (= T55), T189 (= T191), K217 (= K219), A219 (≠ K221), D247 (= D249), N249 (= N251), E273 (= E275), G299 (= G301), E300 (= E302), D323 (= D325), P349 (= P351), H350 (= H352), A351 (= A353), D367 (= D369), K374 (≠ S376), E381 (= E383)
- binding 6-deoxy-L-galactonic acid: G21 (= G22), D23 (= D24), Y31 (= Y32), W193 (= W195), K217 (= K219), D247 (= D249), E300 (= E302), H350 (= H352), G352 (= G354), E381 (= E383)
- binding magnesium ion: D247 (= D249), E273 (= E275), E300 (= E302)
4h19A Crystal structure of an enolase (mandelate racemase subgroup, target efi-502087) from agrobacterium tumefaciens, with bound mg and d- ribonohydroxamate, ordered loop
30% identity, 97% coverage: 4:423/434 of query aligns to 3:367/372 of 4h19A
- active site: I20 (≠ L20), T51 (= T55), T143 (= T191), K172 (= K219), K174 (= K221), D203 (= D249), N205 (= N251), E229 (= E275), G254 (= G301), E255 (= E302), Q276 (= Q323), D278 (= D325), H305 (= H352), A306 (= A353), G307 (= G354), E327 (= E383)
- binding (2R,3R,4R)-N,2,3,4,5-pentakis(oxidanyl)pentanamide: D22 (= D24), H25 (≠ N27), H52 (vs. gap), K172 (= K219), K174 (= K221), D203 (= D249), N205 (= N251), E229 (= E275), E255 (= E302), H305 (= H352), E327 (= E383)
- binding calcium ion: D268 (≠ Q315), H298 (= H345)
- binding magnesium ion: D203 (= D249), E229 (= E275), E255 (= E302)
2pp1A Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate (see paper)
34% identity, 53% coverage: 189:419/434 of query aligns to 162:381/395 of 2pp1A
- active site: K192 (= K219), K194 (= K221), D223 (= D249), N225 (= N251), E249 (= E275), G274 (= G301), E275 (= E302), D298 (= D325), H325 (= H352), E345 (= E383)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: F168 (≠ W195), K194 (= K221), E275 (= E302), H325 (= H352), E345 (= E383)
- binding magnesium ion: D223 (= D249), E249 (= E275), E275 (= E302)
Sites not aligning to the query:
Q8ZL58 L-talarate/galactarate dehydratase; TalrD/GalrD; StTGD; EC 4.2.1.156; EC 4.2.1.42 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
34% identity, 53% coverage: 189:419/434 of query aligns to 165:384/398 of Q8ZL58
- K195 (= K219) binding
- K197 (= K221) active site, Proton acceptor; mutation to A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- D226 (= D249) binding
- N228 (= N251) binding
- E252 (= E275) binding
- E278 (= E302) binding
- H328 (= H352) active site, Proton donor/acceptor; mutation H->N,A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- E348 (= E383) binding
Sites not aligning to the query:
- 46:48 binding
- 82:83 binding
3ck5A Crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
27% identity, 97% coverage: 4:424/434 of query aligns to 2:356/357 of 3ck5A
- active site: T19 (≠ D21), T50 (= T55), G137 (≠ L164), K164 (= K219), K166 (= K221), D195 (= D249), N197 (= N251), I220 (= I274), E221 (= E275), I243 (≠ V298), G246 (= G301), E247 (= E302), E268 (≠ Q323), D270 (= D325), H297 (= H352), G298 (= G357), V299 (≠ L358), Y315 (≠ I381), E317 (= E383)
- binding magnesium ion: D195 (= D249), E221 (= E275), E247 (= E302)
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
33% identity, 55% coverage: 188:427/434 of query aligns to 131:377/378 of 4hpnA
- active site: T134 (= T191), K164 (= K219), K166 (= K221), D194 (= D249), N196 (= N251), E220 (= E275), G245 (= G301), E246 (= E302), T247 (≠ H303), Q267 (= Q323), D269 (= D325), H296 (= H352), V297 (≠ A353), W298 (≠ G354), R320 (= R380), E329 (= E383), F330 (≠ Y384), H334 (= H389)
- binding calcium ion: D194 (= D249), D209 (≠ R264), E220 (= E275), G237 (≠ R292), E246 (= E302)
Sites not aligning to the query:
2pp3A Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate (see paper)
34% identity, 53% coverage: 189:419/434 of query aligns to 162:381/395 of 2pp3A
- active site: K192 (= K219), A194 (≠ K221), D223 (= D249), N225 (= N251), E249 (= E275), G274 (= G301), E275 (= E302), D298 (= D325), H325 (= H352), E345 (= E383)
- binding l-glucaric acid: K192 (= K219), D223 (= D249), N225 (= N251), E275 (= E302), H325 (= H352), E345 (= E383), F347 (≠ V385)
- binding magnesium ion: D223 (= D249), E249 (= E275), E275 (= E302)
Sites not aligning to the query:
Q9RKF7 3,6-anhydro-alpha-L-galactonate cycloisomerase; AHGA cycloisomerase; EC 5.5.1.25 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
27% identity, 97% coverage: 4:424/434 of query aligns to 2:359/361 of Q9RKF7
- D195 (= D249) binding
- E221 (= E275) binding
- E247 (= E302) binding
5xd8B Crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase (see paper)
28% identity, 72% coverage: 112:423/434 of query aligns to 103:360/367 of 5xd8B
- active site: G140 (vs. gap), K167 (= K219), K169 (= K221), D198 (= D249), N200 (= N251), E224 (= E275), G249 (= G301), E250 (= E302), Q271 (= Q323), D273 (= D325), H300 (= H352), G301 (= G357), M302 (≠ L358), W317 (≠ S376), E319 (= E378), P324 (≠ E383)
- binding magnesium ion: D198 (= D249), E224 (= E275), E250 (= E302)
Sites not aligning to the query:
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
29% identity, 49% coverage: 212:423/434 of query aligns to 141:348/351 of 5olcC
- active site: K148 (= K219), K150 (= K221), D178 (= D249), N180 (= N251), E204 (= E275), G229 (= G301), E230 (= E302), D253 (= D325), H280 (= H352), E304 (≠ S374), E309 (≠ G379)
- binding magnesium ion: D178 (= D249), E204 (= E275), E230 (= E302)
3stpA Crystal structure of a putative galactonate dehydratase
27% identity, 57% coverage: 107:354/434 of query aligns to 108:318/390 of 3stpA
- active site: S151 (≠ T191), K177 (= K219), R179 (≠ K221), P189 (≠ G224), E214 (≠ D249), Y216 (≠ N251), E240 (= E275), G265 (= G301), E266 (= E302), H267 (= H303), Q287 (= Q323), D289 (= D325), I311 (≠ V347), H316 (= H352)
- binding magnesium ion: E214 (≠ D249), E240 (= E275), E266 (= E302)
Sites not aligning to the query:
3sjnA Crystal structure of enolase spea_3858 (target efi-500646) from shewanella pealeana with magnesium bound
25% identity, 97% coverage: 4:423/434 of query aligns to 4:370/373 of 3sjnA
- active site: S46 (≠ T55), L49 (≠ R58), T139 (≠ F151), K165 (≠ T190), G167 (≠ S192), M171 (≠ L196), D198 (= D249), A200 (≠ N251), E225 (= E275), I247 (≠ V298), G250 (= G301), E251 (= E302), S252 (≠ H303), Q272 (= Q323), D274 (= D325), H301 (= H352), G302 (≠ A353), F303 (≠ G354), M325 (≠ L382), E326 (= E383), Q329 (≠ D386), S331 (≠ L388)
- binding magnesium ion: D198 (= D249), E225 (= E275), E251 (= E302)
3ekgA Crystal structure of l-rhamnonate dehydratase from azotobacter vinelandii complexed with mg and l-tartrate
26% identity, 86% coverage: 54:425/434 of query aligns to 73:393/395 of 3ekgA
- active site: K178 (≠ R208), P180 (≠ A210), G184 (= G214), S186 (≠ T216), E190 (≠ Q220), D215 (= D249), W217 (≠ N251), E241 (= E275), T266 (≠ A299), G268 (= G301), E269 (= E302), Q290 (= Q323), D292 (= D325), H319 (= H352), E339 (≠ D369), D348 (≠ E378)
- binding magnesium ion: D215 (= D249), E241 (= E275), E269 (= E302)
Query Sequence
>WP_086511801.1 NCBI__GCF_002151265.1:WP_086511801.1
MTTITRLEVQDIRFPTSRSLDGSDAMNAAPDYSATYVTLHTDAGNGLSGHGLTFTIGRGN
EICVKAVESLAYLIEGRRLDDITAEMGRFWRELTSGDSQLRWIGPEKGAIHLATAAIVNA
VWDLWAKTEGKPVWKLLVDMPPEQLIRCLDFRFVTDALTPEEALGLLRRNAAGRADRERE
MREQGYPAYTTSAGWLGYDDDKVRRLAREALAEGWTHFKQKVGGNLEEDRRRAQILREEI
GWERALMMDANQMWDVDEAIANMRRLAEFDPLWIEEPTSPDDILGHAEIRRRLGSIGVAT
GEHCHNRVMFKQLLQAGALDYCQVDAARLGGLNEVIVVLLLAAKHGVPVCPHAGGVGLCE
YVQHVSLFDYIAVSGSLEGRILEYVDHLHEHFLHPVTIRNGRYQVPTAPGYSISLHPESL
SRHAYPDGAAWQDG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory