SitesBLAST
Comparing WP_086511947.1 NCBI__GCF_002151265.1:WP_086511947.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
44% identity, 88% coverage: 15:275/298 of query aligns to 12:271/692 of 6iunB
Sites not aligning to the query:
- active site: 407, 428, 440, 478
- binding nicotinamide-adenine-dinucleotide: 300, 301, 302, 321, 322, 365, 377, 378, 380, 384, 388, 405, 407
Q08426 Peroxisomal bifunctional enzyme; PBE; PBFE; L-bifunctional protein; LBP; Multifunctional enzyme 1; MFE1; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 from Homo sapiens (Human) (see 5 papers)
38% identity, 92% coverage: 10:282/298 of query aligns to 8:280/723 of Q08426
- V40 (≠ L42) to G: in dbSNP:rs1062551
- I41 (≠ E43) to R: in dbSNP:rs1062552
- T75 (vs. gap) to I: in dbSNP:rs1062553
- K165 (≠ E166) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-171; Q-346 and Q-584.
- K171 (≠ G172) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-346 and Q-584.
- A274 (= A276) to T: in dbSNP:rs2302819
Sites not aligning to the query:
- 3 E → K: in FRTS3; the mutant is mistargeted to mitochondria; results in impaired mitochondrial oxidative phosphorylation and defects in the transport of fluids across the epithelium of renal proximal tubular cells; dbSNP:rs398124646
- 325 A → G: in dbSNP:rs1062555
- 346 modified: N6-acetyllysine; K→Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-584.
- 584 modified: N6-acetyllysine; alternate; K→Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-346.
- 598 K → T: in dbSNP:rs1042437
- 606 T → P: in dbSNP:rs1042438
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
40% identity, 60% coverage: 5:184/298 of query aligns to 6:192/259 of 5zaiC
- active site: A65 (= A63), F70 (= F68), S82 (≠ P78), R86 (vs. gap), G110 (= G102), E113 (= E105), P132 (= P124), E133 (= E125), I138 (≠ L130), P140 (= P132), G141 (= G133)
- binding coenzyme a: K24 (≠ P22), L25 (≠ V23), A63 (= A61), G64 (= G62), A65 (= A63), D66 (= D64), I67 (= I65), P132 (= P124), R166 (≠ P158)
Sites not aligning to the query:
3zw9A Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2- methylbutanoyl-coa (see paper)
37% identity, 88% coverage: 15:276/298 of query aligns to 16:276/723 of 3zw9A
- active site: A64 (= A63), F69 (= F68), G79 (≠ P78), G103 (= G102), E106 (= E105), P125 (= P124), E126 (= E125), P133 (= P132), G134 (= G133), K252 (≠ A252)
- binding (2s,3s)-3-hydroxy-2-methylbutanoyl-coa: V24 (= V23), A62 (= A61), G63 (= G62), A64 (= A63), I66 (= I65), G102 (= G101), G103 (= G102), E106 (= E105), E126 (= E125), P133 (= P132), Y159 (≠ P158)
Sites not aligning to the query:
- active site: 413, 434, 446, 484
- binding nicotinamide-adenine-dinucleotide: 305, 306, 308, 309, 310, 329, 334, 383, 384, 385, 386, 411, 413, 434
5omoA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with with 3s-hydroxy-decanoyl-coa and 3-keto- decanoyl-coa
37% identity, 88% coverage: 15:276/298 of query aligns to 18:278/725 of 5omoA
- active site: A66 (= A63), F71 (= F68), G81 (≠ P78), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), P135 (= P132), G136 (= G133), K254 (≠ A252)
- binding (s)-3-hydroxydecanoyl-coa: P25 (= P22), V26 (= V23), A28 (= A25), P31 (≠ Q28), A64 (= A61), A66 (= A63), D67 (= D64), I68 (= I65), L103 (= L100), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), Y161 (≠ P158), F260 (= F258)
Sites not aligning to the query:
5mgbA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and NAD (see paper)
37% identity, 88% coverage: 15:276/298 of query aligns to 18:278/725 of 5mgbA
- active site: A66 (= A63), F71 (= F68), G81 (≠ P78), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), P135 (= P132), G136 (= G133), K254 (≠ A252)
- binding acetoacetyl-coenzyme a: P25 (= P22), V26 (= V23), A64 (= A61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), G105 (= G102), E128 (= E125), Y161 (≠ P158)
Sites not aligning to the query:
- active site: 415, 436, 448, 486
- binding nicotinamide-adenine-dinucleotide: 307, 308, 310, 311, 312, 331, 332, 336, 386, 387, 388, 413, 415, 436
3zwcA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa (see paper)
37% identity, 88% coverage: 15:276/298 of query aligns to 18:278/725 of 3zwcA
- active site: A66 (= A63), F71 (= F68), G81 (≠ P78), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), P135 (= P132), G136 (= G133), K254 (≠ A252)
- binding (s)-3-hydroxydecanoyl-coa: V26 (= V23), A64 (= A61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), G77 (≠ S74), L78 (≠ P75), L80 (= L77), V101 (= V98), G104 (= G101), G105 (= G102), E108 (= E105), E128 (= E125), F260 (= F258)
Sites not aligning to the query:
- active site: 415, 436, 448, 486
- binding nicotinamide-adenine-dinucleotide: 308, 310, 311, 312, 331, 336, 385, 386, 387, 388, 393, 413, 415, 436
2x58A The crystal structure of mfe1 liganded with coa (see paper)
37% identity, 88% coverage: 15:276/298 of query aligns to 18:278/725 of 2x58A
- active site: A66 (= A63), F71 (= F68), G81 (≠ P78), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), P135 (= P132), G136 (= G133), K254 (≠ A252)
- binding coenzyme a: V26 (= V23), A28 (= A25), A64 (= A61), A66 (= A63), D67 (= D64), I68 (= I65), E128 (= E125)
Sites not aligning to the query:
- active site: 415, 436, 448, 486
- binding adenosine-5'-diphosphate: 310, 311, 312, 331, 332, 336, 386, 392
6zicAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with 3s-hydroxybutanoyl-coa and nadh'
37% identity, 88% coverage: 15:276/298 of query aligns to 18:278/723 of 6zicAAA
- active site: A66 (= A63), F71 (= F68), G81 (≠ P78), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), G136 (= G133), K254 (≠ A252)
- binding 3-hydroxybutanoyl-coenzyme a: P25 (= P22), V26 (= V23), A28 (= A25), A66 (= A63), D67 (= D64), I68 (= I65), G104 (= G101), G105 (= G102), E108 (= E105), E128 (= E125), Y161 (≠ P158)
Sites not aligning to the query:
- active site: 413, 434, 446, 484
- binding 1,4-dihydronicotinamide adenine dinucleotide: 308, 310, 311, 312, 331, 332, 336, 383, 384, 385, 386, 390, 391, 411, 413, 434
6z5oAAA Peroxisomal bifunctional enzyme (see paper)
37% identity, 88% coverage: 15:276/298 of query aligns to 19:279/716 of 6z5oAAA
- active site: A67 (= A63), F72 (= F68), G82 (≠ P78), G106 (= G102), E109 (= E105), P128 (= P124), E129 (= E125), G137 (= G133), K255 (≠ A252)
- binding coenzyme a: P26 (= P22), V27 (= V23), A65 (= A61), D68 (= D64), I69 (= I65), P128 (= P124), Y162 (≠ P158), F277 (= F274)
- binding nicotinamide: A67 (= A63), E109 (= E105), E129 (= E125), P136 (= P132), F261 (= F258)
Sites not aligning to the query:
- active site: 409, 430, 442, 480
- binding coenzyme a: 281
- binding nicotinamide-adenine-dinucleotide: 309, 311, 312, 313, 332, 333, 337, 379, 380, 381, 382, 387, 407, 409, 430
6zibAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and nadh'
37% identity, 88% coverage: 15:276/298 of query aligns to 18:278/723 of 6zibAAA
- active site: A66 (= A63), F71 (= F68), G81 (≠ P78), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), G136 (= G133), K254 (≠ A252)
- binding acetoacetyl-coenzyme a: P25 (= P22), V26 (= V23), A64 (= A61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), G104 (= G101), G105 (= G102), E128 (= E125), Y161 (≠ P158)
Sites not aligning to the query:
- active site: 413, 434, 446, 484
- binding 1,4-dihydronicotinamide adenine dinucleotide: 310, 311, 312, 331, 332, 336, 383, 384, 385, 386, 411, 434
3zwaA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa (see paper)
37% identity, 88% coverage: 15:276/298 of query aligns to 19:279/727 of 3zwaA
- active site: A67 (= A63), F72 (= F68), G82 (≠ P78), G106 (= G102), E109 (= E105), P128 (= P124), E129 (= E125), P136 (= P132), G137 (= G133), K255 (≠ A252)
- binding (S)-3-Hydroxyhexanoyl-CoA: V27 (= V23), A65 (= A61), G66 (= G62), A67 (= A63), D68 (= D64), I69 (= I65), L104 (= L100), E109 (= E105), R124 (= R120), E129 (= E125), L132 (= L128), G137 (= G133), Y162 (≠ P158)
Sites not aligning to the query:
3zwbA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa (see paper)
37% identity, 88% coverage: 15:276/298 of query aligns to 18:278/725 of 3zwbA
- active site: A66 (= A63), G81 (≠ P78), G105 (= G102), E108 (= E105), P127 (= P124), A128 (≠ E125), P135 (= P132), G136 (= G133)
- binding (2E)-Hexenoyl-CoA: P25 (= P22), V26 (= V23), A28 (= A25), A64 (= A61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), V101 (= V98), L103 (= L100), G105 (= G102), E108 (= E105), G136 (= G133), Y161 (≠ P158)
Sites not aligning to the query:
6eqoA Tri-functional propionyl-coa synthase of erythrobacter sp. Nap1 with bound NADP+ and phosphomethylphosphonic acid adenylate ester (see paper)
38% identity, 77% coverage: 16:245/298 of query aligns to 870:1107/1804 of 6eqoA
Sites not aligning to the query:
- binding phosphomethylphosphonic acid adenylate ester: 456, 458, 535, 536, 537, 538, 558, 559, 560, 561, 562, 688, 714
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 1261, 1265, 1379, 1400, 1403, 1404, 1405, 1424, 1425, 1429, 1444, 1492, 1493, 1497, 1514, 1517, 1713, 1730, 1731, 1774
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
34% identity, 87% coverage: 18:275/298 of query aligns to 21:294/719 of 6tnmA
Sites not aligning to the query:
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 87% coverage: 18:275/298 of query aligns to 21:294/729 of P21177
- G116 (= G102) mutation to F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
Sites not aligning to the query:
- 322 G→A: 10-fold increase in KM for NADH.
- 450 active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
31% identity, 87% coverage: 10:269/298 of query aligns to 46:338/763 of P40939
- V282 (≠ L222) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (≠ V236) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
Sites not aligning to the query:
- 342 L → P: in LCHAD deficiency; dbSNP:rs137852772
- 510 active site, For hydroxyacyl-coenzyme A dehydrogenase activity; E → Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
43% identity, 55% coverage: 9:173/298 of query aligns to 12:176/254 of 2dubA
- active site: A67 (= A63), M72 (≠ F68), S82 (vs. gap), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), T133 (≠ L130), P135 (= P132), G136 (= G133)
- binding octanoyl-coenzyme a: K25 (≠ P22), A26 (vs. gap), L27 (≠ V23), A29 (= A25), A65 (= A61), A67 (= A63), D68 (= D64), I69 (= I65), K70 (= K66), G105 (= G102), E108 (= E105), P127 (= P124), E128 (= E125), G136 (= G133), A137 (= A134)
Sites not aligning to the query:
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
42% identity, 55% coverage: 9:173/298 of query aligns to 13:180/258 of 1mj3A
- active site: A68 (= A63), M73 (≠ F68), S83 (vs. gap), L85 (vs. gap), G109 (= G102), E112 (= E105), P131 (= P124), E132 (= E125), T137 (≠ L130), P139 (= P132), G140 (= G133)
- binding hexanoyl-coenzyme a: K26 (≠ P22), A27 (vs. gap), L28 (≠ V23), A30 (= A25), A66 (= A61), G67 (= G62), A68 (= A63), D69 (= D64), I70 (= I65), G109 (= G102), P131 (= P124), E132 (= E125), L135 (= L128), G140 (= G133)
Sites not aligning to the query:
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
43% identity, 55% coverage: 9:173/298 of query aligns to 11:180/258 of 1ey3A
- active site: A66 (= A63), M71 (≠ F68), S81 (≠ L77), L85 (≠ I81), G109 (= G102), E112 (= E105), P131 (= P124), E132 (= E125), T137 (≠ L130), P139 (= P132), G140 (= G133)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ P22), L26 (≠ V23), A28 (= A25), A64 (= A61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), L85 (≠ I81), W88 (vs. gap), G109 (= G102), P131 (= P124), L135 (= L128), G140 (= G133)
Sites not aligning to the query:
Query Sequence
>WP_086511947.1 NCBI__GCF_002151265.1:WP_086511947.1
MCNPVTLTRHGNCGLITLFSPPVNALSQAVRSGLVAALDAALEDPQVAWILLQSGGRCFS
AGADIKEFGKPPQSPVLPEVIDAIEDSPKPVVAWLHGVSLGGGLELAMACHYRLAAPDAR
FGLPEVKLGLIPGAGGTQRLPRLIGLEAALEMILSGEPIGTRQAHELGLVDGVADQGHTP
EAARLAMAAELAGQGVRPTRERELVATGQAPLAWLAAQRESLALPASGDLAPLKAVEALE
AAMTHPFDKALARERELFLECLASPQRQAKVEAFLARGRDSRSLNAGGGGDTTRGTTA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory