SitesBLAST
Comparing WP_086511983.1 NCBI__GCF_002151265.1:WP_086511983.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4whxA X-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate
53% identity, 99% coverage: 4:322/322 of query aligns to 2:306/306 of 4whxA
2ej0B Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase with pyridoxamine 5'-phosphate
43% identity, 98% coverage: 7:320/322 of query aligns to 3:302/305 of 2ej0B
- active site: F35 (= F39), G37 (= G41), K158 (= K161), E192 (= E195), L215 (= L218)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R58 (= R62), Y163 (= Y166), E192 (= E195), G195 (≠ A198), E196 (≠ A199), L215 (= L218), G217 (= G220), I218 (= I221), T219 (= T222), G254 (= G258), T255 (= T259)
2ej3A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with gabapentin
43% identity, 98% coverage: 7:320/322 of query aligns to 3:294/297 of 2ej3A
- active site: F35 (= F39), G37 (= G41), K150 (= K161), E184 (= E195), L207 (= L218)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: G187 (≠ A198), G246 (= G258), T247 (= T259), A248 (= A260)
- binding pyridoxal-5'-phosphate: R58 (= R62), K150 (= K161), Y155 (= Y166), E184 (= E195), G187 (≠ A198), L207 (= L218), G209 (= G220), I210 (= I221), T211 (= T222), G246 (= G258), T247 (= T259)
2eiyA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
43% identity, 98% coverage: 7:320/322 of query aligns to 3:294/297 of 2eiyA
- active site: F35 (= F39), G37 (= G41), K150 (= K161), E184 (= E195), L207 (= L218)
- binding 4-methyl valeric acid: F35 (= F39), Y94 (= Y98), T247 (= T259), A248 (= A260)
- binding pyridoxal-5'-phosphate: R58 (= R62), K150 (= K161), Y155 (= Y166), E184 (= E195), G187 (≠ A198), E188 (≠ A199), L207 (= L218), G209 (= G220), I210 (= I221), T211 (= T222), G246 (= G258), T247 (= T259)
1wrvA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase
43% identity, 98% coverage: 7:320/322 of query aligns to 3:294/297 of 1wrvA
- active site: F35 (= F39), G37 (= G41), K150 (= K161), E184 (= E195), L207 (= L218)
- binding pyridoxal-5'-phosphate: R58 (= R62), K150 (= K161), Y155 (= Y166), E184 (= E195), G187 (≠ A198), L207 (= L218), G209 (= G220), I210 (= I221), T211 (= T222), T247 (= T259)
2ej2A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate
42% identity, 98% coverage: 7:320/322 of query aligns to 3:291/294 of 2ej2A
- active site: F35 (= F39), G37 (= G41), K147 (= K161), E181 (= E195), L204 (= L218)
- binding 4-[(1,3-dicarboxy-propylamino)-methyl]-3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridinium: R58 (= R62), Y94 (= Y98), Y152 (= Y166), E181 (= E195), G184 (≠ A198), E185 (≠ A199), L204 (= L218), G206 (= G220), I207 (= I221), T208 (= T222), T244 (= T259), A245 (= A260)
1iyeA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
42% identity, 93% coverage: 10:310/322 of query aligns to 4:295/304 of 1iyeA
- active site: F33 (= F39), G35 (= G41), K156 (= K161), A157 (≠ T162), E190 (= E195), L214 (= L218)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: R56 (= R62), Y92 (= Y98), Y126 (= Y131), K156 (= K161), Y161 (= Y166), E190 (= E195), G193 (≠ A198), E194 (≠ A199), N195 (= N200), L214 (= L218), G216 (= G220), I217 (= I221), T218 (= T222), G253 (= G258), T254 (= T259), A255 (= A260)
1iydA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
42% identity, 93% coverage: 10:310/322 of query aligns to 4:295/304 of 1iydA
- active site: F33 (= F39), G35 (= G41), K156 (= K161), A157 (≠ T162), E190 (= E195), L214 (= L218)
- binding glutaric acid: Y92 (= Y98), Y126 (= Y131), A255 (= A260)
- binding pyridoxal-5'-phosphate: R56 (= R62), K156 (= K161), Y161 (= Y166), E190 (= E195), G193 (≠ A198), E194 (≠ A199), L214 (= L218), G216 (= G220), I217 (= I221), T218 (= T222), T254 (= T259)
1i1mA Crystal structure of escherichia coli branched-chain amino acid aminotransferase. (see paper)
42% identity, 93% coverage: 10:310/322 of query aligns to 4:295/304 of 1i1mA
- active site: K156 (= K161)
- binding 4-methyl valeric acid: Y92 (= Y98), K156 (= K161), T254 (= T259), A255 (= A260)
- binding pyridoxal-5'-phosphate: R56 (= R62), K156 (= K161), Y161 (= Y166), E190 (= E195), G193 (≠ A198), E194 (≠ A199), L214 (= L218), G216 (= G220), I217 (= I221), T218 (= T222), G253 (= G258), T254 (= T259)
1i1lA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase. (see paper)
42% identity, 93% coverage: 10:310/322 of query aligns to 4:295/304 of 1i1lA
- active site: K156 (= K161)
- binding 2-methylleucine: Y92 (= Y98), K156 (= K161), T254 (= T259), A255 (= A260)
- binding pyridoxal-5'-phosphate: R56 (= R62), K156 (= K161), Y161 (= Y166), E190 (= E195), G193 (≠ A198), G216 (= G220), I217 (= I221), T218 (= T222), T254 (= T259)
6thqB Crystal structure of branched-chain aminotransferase from thermophilic archaea thermoproteus uzoniensis with norvaline
38% identity, 97% coverage: 11:322/322 of query aligns to 9:300/301 of 6thqB
- active site: F37 (= F39), K156 (= K161), E190 (= E195), L214 (= L218)
- binding pyridoxal-5'-phosphate: R60 (= R62), K156 (= K161), Y161 (= Y166), E190 (= E195), N195 (= N200), L214 (= L218), G216 (= G220), I217 (= I221), T218 (= T222), T254 (= T259)
- binding 2-[o-phosphonopyridoxyl]-amino-pentanoic acid: R60 (= R62), Y97 (= Y98), K156 (= K161), Y161 (= Y166), E190 (= E195), G193 (≠ A198), E194 (≠ A199), N195 (= N200), G216 (= G220), I217 (= I221), T218 (= T222), G253 (= G258), T254 (= T259), A255 (= A260)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
38% identity, 93% coverage: 10:307/322 of query aligns to 3:284/290 of 5mr0D
- active site: F32 (= F39), G34 (= G41), K150 (≠ T162), E183 (= E195), L206 (= L218)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R62), G100 (= G111), L101 (= L112), K150 (≠ T162), Y154 (= Y166), E183 (= E195), G186 (≠ A198), D187 (≠ A199), L206 (= L218), I209 (= I221), T210 (= T222), G245 (= G258), T246 (= T259)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
39% identity, 92% coverage: 11:307/322 of query aligns to 5:285/290 of 5e25A
- active site: F33 (= F39), G35 (= G41), K151 (≠ T162), E184 (= E195), L207 (= L218)
- binding 2-oxoglutaric acid: Y88 (= Y98), K151 (≠ T162), T247 (= T259), A248 (= A260)
- binding pyridoxal-5'-phosphate: R52 (= R62), K151 (≠ T162), Y155 (= Y166), E184 (= E195), G187 (≠ A198), D188 (≠ A199), L207 (= L218), G209 (= G220), I210 (= I221), T211 (= T222), G246 (= G258), T247 (= T259)
6q8eA Crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum in pmp-form (see paper)
37% identity, 97% coverage: 10:322/322 of query aligns to 5:304/307 of 6q8eA
- active site: F34 (= F39), K156 (= K161), E190 (= E195), L214 (= L218)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R59 (= R62), K156 (= K161), Y161 (= Y166), E190 (= E195), G193 (≠ A198), S194 (≠ A199), C195 (≠ N200), L214 (= L218), S216 (≠ G220), I217 (= I221), T218 (= T222), G254 (= G258), T255 (= T259)
7neaA Crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum (m3 mutant). (see paper)
36% identity, 97% coverage: 10:322/322 of query aligns to 5:304/309 of 7neaA
- active site: F34 (= F39), K156 (= K161), E190 (= E195), L214 (= L218)
- binding pyridoxal-5'-phosphate: R59 (= R62), K156 (= K161), Y161 (= Y166), E190 (= E195), G193 (≠ A198), S194 (≠ A199), L214 (= L218), S216 (≠ G220), I217 (= I221), T218 (= T222), T255 (= T259)
6h65C Crystal structure of the branched-chain-amino-acid aminotransferase from haliangium ochraceum
32% identity, 96% coverage: 12:319/322 of query aligns to 8:303/308 of 6h65C
- active site: F35 (= F39), K158 (= K161), E192 (= E195), L216 (= L218)
- binding pyridoxal-5'-phosphate: R60 (= R62), K158 (= K161), Y163 (= Y166), E192 (= E195), A196 (= A199), L216 (= L218), S218 (≠ G220), V219 (≠ I221), T220 (= T222), G256 (= G258), T257 (= T259)
7z79B Crystal structure of aminotransferase-like protein from variovorax paradoxus
31% identity, 90% coverage: 11:301/322 of query aligns to 18:292/306 of 7z79B
- binding pyridoxal-5'-phosphate: W46 (≠ F39), R65 (= R62), N166 (≠ K161), S202 (≠ A198), T203 (≠ A199), F222 (≠ L218), G224 (= G220), I225 (= I221), T226 (= T222), G261 (= G258), T262 (= T259)
7p3tB Transaminase of gamma-proteobacterium (see paper)
30% identity, 86% coverage: 11:288/322 of query aligns to 6:276/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R62), K153 (= K161), R157 (≠ H165), E186 (= E195), S187 (≠ A196), A188 (≠ S197), A189 (= A198), S190 (≠ A199), G210 (= G220), I211 (= I221), T212 (= T222), T248 (= T259)
3uzoA Crystal structures of branched-chain aminotransferase from deinococcus radiodurans complexes with alpha-ketoisocaproate and l-glutamate suggest its radio-resistance for catalysis (see paper)
34% identity, 79% coverage: 12:266/322 of query aligns to 21:288/335 of 3uzoA
- active site: K179 (= K161)
- binding glutamic acid: Y48 (= Y34), F53 (= F39), R122 (≠ K100), V134 (≠ L112), Y152 (= Y131), T281 (= T259), A282 (= A260)
- binding pyridoxal-5'-phosphate: R77 (= R62), K179 (= K161), Y184 (= Y166), E215 (= E195), G217 (≠ S197), A218 (= A198), A219 (= A199), N220 (= N200), L240 (= L218), S242 (≠ G220), I243 (= I221), T244 (= T222), G280 (= G258), T281 (= T259)
3uzbA Crystal structures of branched-chain aminotransferase from deinococcus radiodurans complexes with alpha-ketoisocaproate and l-glutamate suggest its radio-resistance for catalysis (see paper)
34% identity, 79% coverage: 12:266/322 of query aligns to 21:288/335 of 3uzbA
- active site: K179 (= K161)
- binding 2-oxo-4-methylpentanoic acid: Y120 (= Y98), K179 (= K161), T281 (= T259), A282 (= A260)
- binding pyridoxal-5'-phosphate: R77 (= R62), K179 (= K161), Y184 (= Y166), E215 (= E195), G217 (≠ S197), A218 (= A198), A219 (= A199), N220 (= N200), S242 (≠ G220), I243 (= I221), T244 (= T222), G280 (= G258), T281 (= T259)
Query Sequence
>WP_086511983.1 NCBI__GCF_002151265.1:WP_086511983.1
MTPLYDRDGWIWLDGEWLPWRDAKTHLLTHTLHYGMGCFEGVRAYAGAHGTHLFRVAEHT
RRLLDSAHALDIPVAFDEEVLIEAQRQCLVRNELRNAYLKPTVFFGAEGLGLRAKGLSVH
VMIAAWDLGDYVSSEAATLGLRALTSSWARHHVNISLCRAKTNGHYVNSILALNTAVKAG
FDEAIMLDPEGYVAEASAANVFLLRDGALHTPEVTSCLQGITRDSVIHLAREVLGLEVRE
RRITRDELYTADEAFVTGTAAEILPLRELDGRHIGARAGAPLPGQPIDANSVTAQLQQLY
RQVTRGELEDGLANYGVWLTSM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory