SitesBLAST
Comparing WP_089214500.1 NCBI__GCF_900188185.1:WP_089214500.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
52% identity, 100% coverage: 2:607/607 of query aligns to 1:608/608 of 4amvA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99), Y248 (= Y248), E481 (= E479), K485 (= K483), E488 (= E486), H504 (= H502), K603 (= K602)
- binding fructose -6-phosphate: G301 (= G299), T302 (= T300), S303 (= S301), S347 (= S345), Q348 (= Q346), S349 (= S347), T352 (= T350), S401 (= S398), K485 (= K483), E488 (= E486)
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
52% identity, 100% coverage: 2:607/607 of query aligns to 1:608/608 of 1jxaA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99), Y248 (= Y248), E481 (= E479), K485 (= K483), E488 (= E486), H504 (= H502), K603 (= K602)
- binding glucose-6-phosphate: T302 (= T300), S303 (= S301), S347 (= S345), Q348 (= Q346), S349 (= S347), T352 (= T350), S401 (= S398), K485 (= K483), E488 (= E486)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
52% identity, 100% coverage: 2:607/607 of query aligns to 1:608/608 of 2j6hA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99), Y248 (= Y248), E481 (= E479), K485 (= K483), E488 (= E486), H504 (= H502), K603 (= K602)
- binding glucose-6-phosphate: T302 (= T300), S347 (= S345), Q348 (= Q346), S349 (= S347), T352 (= T350), V399 (= V396), S401 (= S398), E488 (= E486)
- binding 5-oxo-l-norleucine: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N98), G99 (= G99), D123 (= D123)
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
37% identity, 100% coverage: 2:607/607 of query aligns to 1:663/663 of 6r4eA
- active site: L7 (≠ I8), R32 (= R27), W95 (= W74), N122 (= N98), G123 (= G99), E536 (= E479), K540 (= K483), E543 (= E486), H559 (= H502), K658 (= K602)
- binding glucose-6-phosphate: T358 (= T300), S359 (= S301), S403 (= S345), Q404 (= Q346), S405 (= S347), T408 (= T350), S456 (= S398), K540 (= K483), E543 (= E486)
- binding glutamic acid: C1 (= C2), R94 (= R73), W95 (= W74), T97 (= T76), G123 (= G99), D147 (= D123)
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
37% identity, 100% coverage: 2:607/607 of query aligns to 1:660/660 of 6svmA
- active site: L7 (≠ I8), R32 (= R27), W95 (= W74), N122 (= N98), G123 (= G99), E533 (= E479), K537 (= K483), E540 (= E486), H556 (= H502), K655 (= K602)
- binding glucose-6-phosphate: C353 (= C298), T355 (= T300), S356 (= S301), S400 (= S345), Q401 (= Q346), S402 (= S347), T405 (= T350), S453 (= S398), K537 (= K483), E540 (= E486)
- binding glutamic acid: C1 (= C2), R94 (= R73), W95 (= W74), T97 (= T76), H107 (= H86), G123 (= G99), D147 (= D123)
- binding magnesium ion: S434 (≠ A379), R435 (= R380), T437 (≠ A382)
- binding uridine-diphosphate-n-acetylgalactosamine: Q289 (≠ G237), R322 (≠ Y270), G334 (≠ Q282), G424 (≠ V369), T426 (≠ V371), S434 (≠ A379), T437 (≠ A382), C439 (≠ L384), G440 (≠ L385), V441 (≠ L386), H442 (≠ P387)
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
37% identity, 99% coverage: 2:600/607 of query aligns to 1:652/652 of 6r4gA
- active site: L7 (≠ I8), R32 (= R27), W95 (= W74), N122 (= N98), G123 (= G99), E532 (= E479), K536 (= K483), E539 (= E486), H555 (= H502)
- binding glucose-6-phosphate: G353 (= G299), T354 (= T300), S355 (= S301), S399 (= S345), Q400 (= Q346), S401 (= S347), T404 (= T350), S452 (= S398), E539 (= E486)
- binding magnesium ion: S433 (≠ A379), R434 (= R380), T436 (≠ A382)
- binding uridine-diphosphate-n-acetylglucosamine: Q288 (≠ G237), R321 (≠ Y270), G333 (≠ Q282), G423 (≠ V369), T425 (≠ V371), S433 (≠ A379), T436 (≠ A382), C438 (≠ L384), G439 (≠ L385), V440 (≠ L386), H441 (≠ P387)
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
36% identity, 100% coverage: 1:607/607 of query aligns to 1:699/699 of Q06210
- TS 394:395 (= TS 300:301) binding substrate
- SQS 439:441 (= SQS 345:347) binding substrate
- T444 (= T350) binding substrate
- H595 (= H502) binding substrate
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
54% identity, 60% coverage: 244:607/607 of query aligns to 2:366/366 of 1morA
- active site: E239 (= E479), K243 (= K483), E246 (= E486), H262 (= H502), K361 (= K602)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T300), S105 (= S345), Q106 (= Q346), S107 (= S347), T110 (= T350), V157 (= V396), A360 (= A601), K361 (= K602)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
54% identity, 60% coverage: 244:607/607 of query aligns to 2:366/366 of 1moqA
- active site: E239 (= E479), K243 (= K483), E246 (= E486), H262 (= H502), K361 (= K602)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (= T300), S61 (= S301), S105 (= S345), Q106 (= Q346), S107 (= S347), T110 (= T350), V157 (= V396), A360 (= A601), K361 (= K602)
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
54% identity, 60% coverage: 244:607/607 of query aligns to 3:367/367 of 1mosA
- active site: E240 (= E479), K244 (= K483), E247 (= E486), H263 (= H502), K362 (= K602)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (= T300), S62 (= S301), S106 (= S345), Q107 (= Q346), S108 (= S347), T111 (= T350), K244 (= K483), E247 (= E486)
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
53% identity, 58% coverage: 244:598/607 of query aligns to 2:357/357 of 7dnrA
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
41% identity, 60% coverage: 245:607/607 of query aligns to 2:365/365 of 2zj4A
- active site: E238 (= E479), K242 (= K483), E245 (= E486), H261 (= H502), K360 (= K602)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (= T300), S61 (= S301), S105 (= S345), Q106 (= Q346), S107 (= S347), T110 (= T350), V156 (= V396), A157 (= A397), K242 (= K483), E245 (= E486)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
41% identity, 60% coverage: 245:607/607 of query aligns to 2:365/365 of 2zj3A
- active site: E238 (= E479), K242 (= K483), E245 (= E486), H261 (= H502), K360 (= K602)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T300), S61 (= S301), S105 (= S345), Q106 (= Q346), S107 (= S347), T110 (= T350), V156 (= V396), A359 (= A601), K360 (= K602)
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
37% identity, 71% coverage: 175:607/607 of query aligns to 281:717/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
39% identity, 58% coverage: 245:595/607 of query aligns to 1:352/352 of 2v4mA
- active site: E237 (= E479), K241 (= K483), E244 (= E486), H260 (= H502)
- binding fructose -6-phosphate: T59 (= T300), S60 (= S301), S104 (= S345), Q105 (= Q346), S106 (= S347), T109 (= T350), A156 (= A397), S157 (= S398), K241 (= K483), E244 (= E486)
1xfgA Glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate (see paper)
50% identity, 39% coverage: 2:238/607 of query aligns to 1:238/238 of 1xfgA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99)
- binding glutamine hydroxamate: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N98), G99 (= G99), D123 (= D123)
1xffA Glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate (see paper)
50% identity, 39% coverage: 2:238/607 of query aligns to 1:238/238 of 1xffA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99)
- binding glutamic acid: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N98), G99 (= G99), D123 (= D123)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
39% identity, 57% coverage: 248:595/607 of query aligns to 2:352/352 of 2pocB
- active site: E236 (= E479), K240 (= K483), E243 (= E486), H259 (= H502)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (= C298), T57 (= T300), S58 (= S301), S102 (= S345), Q103 (= Q346), S104 (= S347), T107 (= T350), E243 (= E486)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (≠ Y270), G36 (≠ Q282), G126 (≠ V369), V128 (= V371), S136 (≠ A379), T139 (≠ A382), C141 (≠ L384), G142 (≠ L385), V143 (≠ L386), H144 (≠ P387)
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
37% identity, 57% coverage: 248:595/607 of query aligns to 2:339/339 of 2putA
- active site: E236 (= E479), K240 (= K483), E243 (= E486)
- binding fructose -6-phosphate: C55 (= C298), T57 (= T300), S102 (= S345), Q103 (= Q346), S104 (= S347), T107 (= T350), A154 (= A397), S155 (= S398), K240 (= K483)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (≠ Y270), G36 (≠ Q282), G126 (≠ V369), V128 (= V371), S136 (≠ A379), T139 (≠ A382), C141 (≠ L384), G142 (≠ L385), V143 (≠ L386), H144 (≠ P387)
2puvA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
37% identity, 58% coverage: 246:595/607 of query aligns to 1:338/338 of 2puvA
- active site: E237 (= E479), K241 (= K483), E244 (= E486)
- binding 5-amino-5-deoxy-1-o-phosphono-d-mannitol: C56 (= C298), T58 (= T300), S103 (= S345), Q104 (= Q346), S105 (= S347), T108 (= T350), A155 (= A397), E244 (= E486)
- binding uridine-diphosphate-n-acetylglucosamine: R25 (≠ Y270), G37 (≠ Q282), G127 (≠ V369), V129 (= V371), S137 (≠ A379), T140 (≠ A382), C142 (≠ L384), G143 (≠ L385), V144 (≠ L386), H145 (≠ P387)
Query Sequence
>WP_089214500.1 NCBI__GCF_900188185.1:WP_089214500.1
MCGIIGIIGKEAVADRLVDGLRRMEYRGYDSAGVCTVEGGELIRRRAEGKLANLVRELGV
NPAPGNVGIAHTRWATHGAPTTSNAHPHATGEVALVHNGIIENFKPLREALAGRGRKFES
ETDTEVVAHLVSEQVEAGHSPADAVKAVLPQLRGAFALAIAFRSHPDLLIGARLGSPLVV
GYGEGETYLGSDALALAPLTQRISYLEEGDWVIIGREGAQIFDSENNPVTREVTTSGVTA
AAVEKGNYRHFMQKEIFEQPTVVAQTLSSYIRPLEQTVALPQMDFDLSKIDRITIVACGT
SFYAGMVAKYWFEQFARVPVDIDVASEFRYRDPVLQPGGLALFISQSGETADTLAALRHC
KAAGQTIAVVVNVPTSSMAREADLLLPTHAGPEIGVASTKAFTCQLAVLAALAAHLALKK
GKLSADEEREIVKHLIEAPAALNAALGHDEDIAAMAHLVAPARDVLYLGRGPDYPLALEG
ALKLKEISYIHAEGYASGEMKHGPIALIDEAVPVIVLAPSGPLFEKTVSNMQEVMARGGK
VVLISDADGIAEAGEGCMATIEMPRVHPLIAPLVYAVPVQLLAYHVAVAKGTDVDQPRNL
AKSVTVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory