Comparing WP_089299593.1 NCBI__GCF_900188115.1:WP_089299593.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q79FW5 PE-PGRS family protein PE_PGRS11; PE-PGRS phosphoglycerate mutase; EC 5.4.2.12 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 97% coverage: 1:203/209 of query aligns to 283:496/584 of Q79FW5
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
34% identity, 78% coverage: 1:164/209 of query aligns to 2:166/207 of 4ij6A
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
28% identity, 79% coverage: 3:168/209 of query aligns to 4:164/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
28% identity, 79% coverage: 3:168/209 of query aligns to 4:164/207 of 1h2eA
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
27% identity, 96% coverage: 2:201/209 of query aligns to 3:207/209 of 4qihA
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
29% identity, 74% coverage: 2:156/209 of query aligns to 4:160/217 of 4pzaB
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
29% identity, 74% coverage: 2:156/209 of query aligns to 5:161/223 of P9WIC7
Sites not aligning to the query:
Q9HIJ2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) (see paper)
30% identity, 44% coverage: 5:95/209 of query aligns to 6:96/200 of Q9HIJ2
>WP_089299593.1 NCBI__GCF_900188115.1:WP_089299593.1
MKLKLVRHAESTANVRKAINTRLPGPPLSDVGRQQADELAARLRSEPVVAVYSSLATRAQ
QTATPVAAAHGVDLQVIDGVHEVFVGQLEDRTDREGVEAYAQVFLPWIQGELHHTMPGGE
SGIEVRDRFVAAISEVRAKHEEEDPDGTVVMVSHGGVMRLGVELLADNVPRSGRVSGLIA
NTGAVVLEAHRDGRWRCVAWDGVDLSGHG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory