Comparing WP_089299603.1 NCBI__GCF_900188115.1:WP_089299603.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8vr6A Crystal structure of the pcryo_0619 n-acetryltransferase from psychrobacter cryohalolentis k5 in the presence of coa-disulfide
43% identity, 67% coverage: 26:135/163 of query aligns to 57:165/177 of 8vr6A
8vr7E Crystal structure of the pcryo_0619 n-acetyltransferase from psychrobacter cryohalolentis k5 int he presence of acetyl coenzyme a
43% identity, 67% coverage: 26:135/163 of query aligns to 58:166/180 of 8vr7E
Sites not aligning to the query:
8vr7B Crystal structure of the pcryo_0619 n-acetyltransferase from psychrobacter cryohalolentis k5 int he presence of acetyl coenzyme a
43% identity, 67% coverage: 26:135/163 of query aligns to 58:166/177 of 8vr7B
Sites not aligning to the query:
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
40% identity, 56% coverage: 51:142/163 of query aligns to 97:187/188 of 3igjC
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
36% identity, 55% coverage: 53:142/163 of query aligns to 97:185/200 of 1krrA
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
36% identity, 55% coverage: 53:142/163 of query aligns to 97:185/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
36% identity, 55% coverage: 53:142/163 of query aligns to 97:185/201 of 1kruA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 55% coverage: 53:142/163 of query aligns to 98:186/203 of P07464
Sites not aligning to the query:
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
35% identity, 56% coverage: 51:142/163 of query aligns to 95:185/186 of 4isxA
Sites not aligning to the query:
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
34% identity, 55% coverage: 51:140/163 of query aligns to 61:166/209 of P50870
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
34% identity, 55% coverage: 51:140/163 of query aligns to 61:166/206 of 1khrA
Sites not aligning to the query:
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
34% identity, 55% coverage: 51:140/163 of query aligns to 61:166/203 of 3dhoA
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
34% identity, 55% coverage: 51:140/163 of query aligns to 61:166/205 of 1kk4A
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
34% identity, 55% coverage: 51:140/163 of query aligns to 61:166/204 of 1mrlA
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
33% identity, 61% coverage: 48:146/163 of query aligns to 92:189/190 of 5u2kA
Sites not aligning to the query:
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
51% identity, 31% coverage: 88:138/163 of query aligns to 113:163/212 of 4husA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
51% identity, 31% coverage: 88:138/163 of query aligns to 113:163/211 of 4hurA
Sites not aligning to the query:
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
48% identity, 36% coverage: 88:145/163 of query aligns to 113:170/207 of 6x3cA
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
51% identity, 31% coverage: 88:138/163 of query aligns to 113:163/206 of 6x3jA
Sites not aligning to the query:
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
51% identity, 31% coverage: 88:138/163 of query aligns to 113:163/203 of 6x3cE
Sites not aligning to the query:
>WP_089299603.1 NCBI__GCF_900188115.1:WP_089299603.1
MRGGFSAAFHAEHDIPPNPYNAHARITGEPVIGEGTWIGAFTVLDGGGGLLRIGDGCDIA
AGAQIYTHSSMRRCVSGRAYDAVDREAVSIGNHVFIGPHVTVMPGVSVGDSAAVLAGSVV
TGDVAARSLVAGVPARPIGHLDIDGPEVRVVYDRAGQDPGRAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory