SitesBLAST
Comparing WP_089301129.1 NCBI__GCF_900188115.1:WP_089301129.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3n8kM Type ii dehydroquinase from mycobacterium tuberculosis complexed with citrazinic acid (see paper)
62% identity, 98% coverage: 1:141/144 of query aligns to 10:150/151 of 3n8kM
- active site: P18 (= P9), N19 (= N10), N82 (= N73), G85 (≠ A76), E106 (= E97), H108 (= H99), R115 (= R106)
- binding 2,6-dioxo-1,2,3,6-tetrahydropyridine-4-carboxylic acid: R26 (= R17), Y31 (= Y22), N82 (= N73), G84 (= G75), H88 (= H79), H108 (= H99), I109 (= I100), S110 (= S101), R119 (= R110)
3n76A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with compound 5 (see paper)
62% identity, 98% coverage: 1:141/144 of query aligns to 2:142/143 of 3n76A
- active site: P10 (= P9), N11 (= N10), R18 (= R17), Y23 (= Y22), N74 (= N73), G77 (≠ A76), E98 (= E97), H100 (= H99), R107 (= R106)
- binding (1s,3r,4r,5s)-1,3,4-trihydroxy-5-(3-phenoxypropyl)cyclohexanecarboxylic acid: N11 (= N10), R14 (= R13), R18 (= R17), Y23 (= Y22), N74 (= N73), G76 (= G75), G77 (≠ A76), H80 (= H79), H100 (= H99), I101 (= I100), S102 (= S101), R111 (= R110)
4kiwA Design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49e [5-[(3-nitrobenzyl)amino]benzene-1,3-dicarboxylic acid] (see paper)
62% identity, 98% coverage: 1:141/144 of query aligns to 1:141/141 of 4kiwA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding 5-[(3-nitrobenzyl)amino]benzene-1,3-dicarboxylic acid: N10 (= N10), L11 (= L11), R13 (= R13), L14 (= L14), Y22 (= Y22), N73 (= N73), G75 (= G75), G76 (≠ A76), H79 (= H79), H99 (= H99), I100 (= I100), S101 (= S101), V103 (= V103), R110 (= R110)
4kiuA Design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49d [5-[(3-nitrobenzyl)oxy]benzene-1,3-dicarboxylic acid] (see paper)
62% identity, 98% coverage: 1:141/144 of query aligns to 1:141/141 of 4kiuA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding 5-[(3-nitrobenzyl)oxy]benzene-1,3-dicarboxylic acid: N10 (= N10), R13 (= R13), L14 (= L14), E18 (= E18), Y22 (= Y22), G75 (= G75), H79 (= H79), H99 (= H99), I100 (= I100), S101 (= S101), R110 (= R110)
4ciwA Crystal structure of mycobacterium tuberculosis type 2 dehydroquinase in complex with (1r,4r,5r)-1,4,5-trihydroxy-3-(2-hydroxy) ethylcyclohex-2-ene-1-carboxylic acid (see paper)
62% identity, 98% coverage: 1:141/144 of query aligns to 1:141/141 of 4ciwA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding (1R,4R,5R)-1,4,5-trihydroxy-3-(2-hydroxy)ethylcyclohex-2-ene-1-carboxylic acid: Y22 (= Y22), N73 (= N73), G75 (= G75), G76 (≠ A76), H79 (= H79), H99 (= H99), I100 (= I100), S101 (= S101), R110 (= R110)
4b6oA Structure of mycobacterium tuberculosis type ii dehydroquinase inhibited by (2s)-2-(4-methoxy)benzyl-3-dehydroquinic acid (see paper)
62% identity, 98% coverage: 1:141/144 of query aligns to 2:142/142 of 4b6oA
- active site: P10 (= P9), N11 (= N10), R18 (= R17), Y23 (= Y22), N74 (= N73), G77 (≠ A76), E98 (= E97), H100 (= H99), R107 (= R106)
- binding (1R,2S,4S,5R)-2-(4-methoxyphenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N11 (= N10), N74 (= N73), G76 (= G75), G77 (≠ A76), H80 (= H79), H100 (= H99), I101 (= I100), S102 (= S101), R111 (= R110)
3n87A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 3 (see paper)
62% identity, 98% coverage: 1:141/144 of query aligns to 1:141/141 of 3n87A
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding (1R,4R,5R)-1,4,5-trihydroxy-3-[3-(phenylcarbonyl)phenyl]cyclohex-2-ene-1-carboxylic acid: N10 (= N10), Y22 (= Y22), N73 (= N73), G75 (= G75), G76 (≠ A76), H79 (= H79), H99 (= H99), I100 (= I100), S101 (= S101), R110 (= R110)
3n86A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 4 (see paper)
62% identity, 98% coverage: 1:141/144 of query aligns to 1:141/141 of 3n86A
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding (1R,5R)-1,5-dihydroxy-4-oxo-3-[3-oxo-3-(phenylamino)propyl]cyclohex-2-ene-1-carboxylic acid: N10 (= N10), R13 (= R13), E18 (= E18), Y22 (= Y22), N73 (= N73), G75 (= G75), G76 (≠ A76), H79 (= H79), D86 (= D86), E90 (≠ Q90), H99 (= H99), I100 (= I100), S101 (= S101), R110 (= R110)
3n59C Type ii dehydroquinase from mycobacterium tuberculosis complexed with 3-dehydroshikimate (see paper)
62% identity, 98% coverage: 1:141/144 of query aligns to 2:142/142 of 3n59C
- active site: P10 (= P9), N11 (= N10), R18 (= R17), N74 (= N73), G77 (≠ A76), E98 (= E97), H100 (= H99), R107 (= R106)
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: R18 (= R17), Y23 (= Y22), G76 (= G75), G77 (≠ A76), H80 (= H79), H100 (= H99), I101 (= I100), S102 (= S101), R111 (= R110)
2xb8A Structure of mycobacterium tuberculosis type ii dehydroquinase in complex with inhibitor compound (2r)-2-(4-methoxybenzyl)-3- dehydroquinic acid (see paper)
62% identity, 98% coverage: 1:141/144 of query aligns to 1:141/141 of 2xb8A
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding (1r,2r,4s,5r)-1,4,5-trihydroxy-2-(4-methoxybenzyl)-3-oxocyclohexanecarboxylic acid: N10 (= N10), L11 (= L11), Y22 (= Y22), N73 (= N73), G75 (= G75), G76 (≠ A76), H79 (= H79), H99 (= H99), I100 (= I100), S101 (= S101), V103 (= V103), R110 (= R110)
4b6pA Structure of mycobacterium tuberculosis type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid (see paper)
62% identity, 98% coverage: 1:141/144 of query aligns to 1:141/142 of 4b6pA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding (1R,2S,4S,5R)-2-(2,3,4,5,6-pentafluorophenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N10 (= N10), L14 (= L14), R17 (= R17), Y22 (= Y22), N73 (= N73), G75 (= G75), G76 (≠ A76), H79 (= H79), H99 (= H99), I100 (= I100), S101 (= S101), R110 (= R110)
4kijA Design and structural analysis of aromatic inhibitors of type ii dehydroquinase dehydratase from mycobacterium tuberculosis - compound 35c [3,4-dihydroxy-5-(3-nitrophenoxy)benzoic acid] (see paper)
62% identity, 98% coverage: 1:141/144 of query aligns to 2:142/142 of 4kijA
- active site: P10 (= P9), N11 (= N10), R18 (= R17), Y23 (= Y22), N74 (= N73), G77 (≠ A76), E98 (= E97), H100 (= H99), R107 (= R106)
- binding 3,4-dihydroxy-5-(3-nitrophenoxy)benzoic acid: E19 (= E18), Y23 (= Y22), N74 (= N73), G76 (= G75), H100 (= H99), I101 (= I100), S102 (= S101), R111 (= R110)
4cl0A Structure of the mycobacterium tuberculosis type ii dehydroquinase inhibited by a 3-dehydroquinic acid derivative
62% identity, 97% coverage: 1:140/144 of query aligns to 1:140/140 of 4cl0A
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding (2r)-2-methyl-3-dehydroquinic acid: R17 (= R17), Y22 (= Y22), N73 (= N73), G75 (= G75), G76 (≠ A76), H79 (= H79), H99 (= H99), I100 (= I100), S101 (= S101), R110 (= R110)
2y71A Structure of mycobacterium tuberculosis type ii dehydroquinase complexed with (1r,4s,5r)-1,4,5-trihydroxy-3-((5-methylbenzo(b) thiophen-2-yl)methoxy)cyclohex-2-enecarboxylate (see paper)
61% identity, 98% coverage: 1:141/144 of query aligns to 1:138/138 of 2y71A
- active site: P9 (= P9), N10 (= N10), Y19 (= Y22), N70 (= N73), G73 (≠ A76), E94 (= E97), H96 (= H99), R103 (= R106)
- binding (1R,4S,5R)-1,4,5-trihydroxy-3-[(5-methyl-1-benzothiophen-2-yl)methoxy]cyclohex-2-ene-1-carboxylic acid: N10 (= N10), R13 (= R13), Y19 (= Y22), N70 (= N73), G72 (= G75), G73 (≠ A76), H76 (= H79), H96 (= H99), I97 (= I100), S98 (= S101), R107 (= R110)
3n8nA Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 6 (see paper)
60% identity, 98% coverage: 1:141/144 of query aligns to 1:137/137 of 3n8nA
- active site: P9 (= P9), N10 (= N10), N69 (= N73), G72 (≠ A76), E93 (= E97), H95 (= H99), R102 (= R106)
- binding (1R,4R,5R)-3-(tert-butylcarbamoyl)-1,4,5-trihydroxycyclohex-2-ene-1-carboxylic acid: N69 (= N73), G71 (= G75), G72 (≠ A76), H95 (= H99), I96 (= I100), S97 (= S101), R106 (= R110)
1h0rA Type ii dehydroquinase from mycobacterium tuberculosis complexed with 2,3-anhydro-quinic acid
60% identity, 98% coverage: 1:141/144 of query aligns to 2:138/139 of 1h0rA
- active site: P10 (= P9), N11 (= N10), Y19 (= Y22), N70 (= N73), G73 (≠ A76), E94 (= E97), H96 (= H99), R103 (= R106)
- binding 2,3 -anhydro-quinic acid: Y19 (= Y22), N70 (= N73), G72 (= G75), G73 (≠ A76), H76 (= H79), H96 (= H99), I97 (= I100), S98 (= S101), R107 (= R110)
4ciyA Crystal structure of mycobacterium tuberculosis type 2 dehydroquinase in complex with (1r,4r,5r)-1,4,5-trihydroxy-3-((1r)-1-hydroxy-2- phenyl)ethylcyclohex-2-en-1-carboxylic acid (see paper)
60% identity, 98% coverage: 1:141/144 of query aligns to 1:136/136 of 4ciyA
- active site: P9 (= P9), N10 (= N10), Y17 (= Y22), N68 (= N73), G71 (≠ A76), E92 (= E97), H94 (= H99), R101 (= R106)
- binding (1R,4R,5R)-1,4,5-trihydroxy-3-[(1R)-1-hydroxy-2-phenyl]ethylcyclohex-2-ene-1-carboxylic acid: N10 (= N10), Y17 (= Y22), N68 (= N73), G70 (= G75), G71 (≠ A76), H74 (= H79), H94 (= H99), I95 (= I100), S96 (= S101), R105 (= R110)
4civA Crystal structure of mycobacterium tuberculosis type 2 dehydroquinase in complex with (1r,4r,5r)-1,4,5-trihydroxy-3-hydroxymethylcyclohex- 2-ene-1-carboxylic acid (see paper)
60% identity, 98% coverage: 1:141/144 of query aligns to 1:136/137 of 4civA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), N68 (= N73), G71 (≠ A76), E92 (= E97), H94 (= H99), R101 (= R106)
- binding (1R,4R,5R)-1,4,5-trihydroxy-3-hydroxymethylcyclohex-2-ene-1-carboxylic acid: R17 (= R17), G70 (= G75), G71 (≠ A76), H94 (= H99), I95 (= I100), S96 (= S101), R105 (= R110)
4v0sA Crystal structure of mycobacterium tuberculosis type ii dehydroquinase d88n mutant inhibited by a 3-dehydroquinic acid derivative
59% identity, 98% coverage: 1:141/144 of query aligns to 3:137/140 of 4v0sA
- active site: P11 (= P9), N12 (= N10), R19 (= R17), Y24 (= Y22), N75 (= N73), G78 (≠ A76), E99 (= E97), H101 (= H99)
- binding (1R,2S,4S,5R)-2-(2,3,4,5,6-pentafluorophenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N6 (≠ L4), N12 (= N10), L16 (= L14), R19 (= R17), Y24 (= Y22), V48 (≠ D46), R50 (= R48), W61 (= W59), Q64 (≠ E62), N75 (= N73), G77 (= G75), G78 (≠ A76), H101 (= H99), I102 (= I100), S103 (= S101)
- binding 3,4-dihydroxy-2-[(2,3,4,5,6-pentafluorophenyl)methyl]benzoic acid: R87 (= R85), N88 (≠ D86)
1h0sA 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with 3-hydroxyimino-quinic acid
59% identity, 98% coverage: 1:141/144 of query aligns to 2:136/137 of 1h0sA
- active site: P10 (= P9), N11 (= N10), R18 (= R17), N68 (= N73), G71 (≠ A76), E92 (= E97), H94 (= H99), R101 (= R106)
- binding 3-hydroxyimino quinic acid: N68 (= N73), G70 (= G75), G71 (≠ A76), H74 (= H79), H94 (= H99), I95 (= I100), S96 (= S101), R105 (= R110)
Query Sequence
>WP_089301129.1 NCBI__GCF_900188115.1:WP_089301129.1
MKVLVLNGPNLNRLGTREPSVYGSTSYSELVGRCEREGAALGLEVDVRQTNHEGELVEWL
HEAADAGRPVVLNAGAWTHYSVAVRDAASQLAAPVLELHISNVHKRESFRQHSVLSDIVT
GVIAGLGVDGYLLALRWMAEHGEQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory