Comparing WP_089301242.1 NCBI__GCF_900188115.1:WP_089301242.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
39% identity, 82% coverage: 23:281/316 of query aligns to 19:280/304 of 1wwkA
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
40% identity, 78% coverage: 36:281/316 of query aligns to 33:280/525 of 3ddnB
Sites not aligning to the query:
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
40% identity, 78% coverage: 36:281/316 of query aligns to 32:279/526 of 3dc2A
Sites not aligning to the query:
7dkmA Phgdh covalently linked to oridonin (see paper)
35% identity, 73% coverage: 52:281/316 of query aligns to 49:281/306 of 7dkmA
Sites not aligning to the query:
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
35% identity, 73% coverage: 52:281/316 of query aligns to 47:279/299 of 6cwaA
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
35% identity, 73% coverage: 52:281/316 of query aligns to 45:277/299 of 6rj2A
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
35% identity, 73% coverage: 52:281/316 of query aligns to 48:280/303 of 6plgA
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
35% identity, 73% coverage: 52:281/316 of query aligns to 47:279/297 of 6rj3A
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
35% identity, 73% coverage: 52:281/316 of query aligns to 48:280/302 of 7ewhA
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
35% identity, 73% coverage: 52:281/316 of query aligns to 48:280/302 of 6rihA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
35% identity, 73% coverage: 52:281/316 of query aligns to 49:281/305 of 6plfA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
35% identity, 73% coverage: 52:281/316 of query aligns to 48:280/301 of 6rj5A
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
35% identity, 73% coverage: 52:281/316 of query aligns to 53:285/533 of O43175
Sites not aligning to the query:
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
36% identity, 70% coverage: 60:281/316 of query aligns to 47:271/292 of 6plfB
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
31% identity, 86% coverage: 36:306/316 of query aligns to 36:315/334 of 5aovA
7cvpA The crystal structure of human phgdh from biortus.
39% identity, 56% coverage: 105:281/316 of query aligns to 56:234/254 of 7cvpA
6rj6A Crystal structure of phgdh in complex with bi-4924 (see paper)
39% identity, 56% coverage: 105:281/316 of query aligns to 7:185/204 of 6rj6A
7va1A Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35
39% identity, 56% coverage: 105:281/316 of query aligns to 6:184/193 of 7va1A
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
39% identity, 56% coverage: 105:281/316 of query aligns to 8:186/195 of 5ofwA
Sites not aligning to the query:
5ofvA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-fluoro-2-methylbenzoic acid (see paper)
39% identity, 56% coverage: 105:281/316 of query aligns to 8:186/195 of 5ofvA
Sites not aligning to the query:
>WP_089301242.1 NCBI__GCF_900188115.1:WP_089301242.1
MRIAILDDYQNVARSFADWDSLEAEITVFTEPLGGHDRVIEALEGFDVVVAMRERTPFPA
RVLHSLPDLKLLVSTGQRNAAIDMDAAHAAGITVCGTGYLPYPTAEATWALILAAARNVP
SEERSVREGGWQRTVGTALRGKTLGLIGLGRLGGQVAQIGRAFGMNVVAWSQNLTAERAS
EHGATALSLGELLGTADVVSIHLVLSDRSRGLLGARELDSMKRGALLVNTSRGPIVDEAA
LLDAVQRGHIRAALDVYDTEPLPADHPLRSAPNTVLTPHIGYVCDDVYRVFYQDAVEDIA
AFEAGSPIRVMTQAGS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory