Comparing WP_089302170.1 NCBI__GCF_900188115.1:WP_089302170.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
1lw5B X-ray structure of l-threonine aldolase (low-specificity) in complex with glycine (see paper)
43% identity, 91% coverage: 8:336/360 of query aligns to 1:332/343 of 1lw5B
1lw4B X-ray structure of l-threonine aldolase (low-specificity) in complex with l-allo-threonine (see paper)
43% identity, 91% coverage: 8:336/360 of query aligns to 1:332/343 of 1lw4B
1jg8D Crystal structure of threonine aldolase (low-specificity)
43% identity, 91% coverage: 8:336/360 of query aligns to 2:333/344 of 1jg8D
Q8RXU4 Low-specificity L-threonine aldolase 1; Threonine aldolase 1; EC 4.1.2.48 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
40% identity, 91% coverage: 9:336/360 of query aligns to 6:342/358 of Q8RXU4
3wgcB Aeromonas jandaei l-allo-threonine aldolase h128y/s292r double mutant (see paper)
42% identity, 93% coverage: 9:343/360 of query aligns to 3:333/333 of 3wgcB
3wlxA Crystal structure of low-specificity l-threonine aldolase from escherichia coli
41% identity, 81% coverage: 8:297/360 of query aligns to 1:284/331 of 3wlxA
Sites not aligning to the query:
4lnmA Structure of escherichia coli threonine aldolase in complex with serine (see paper)
39% identity, 91% coverage: 8:334/360 of query aligns to 1:322/331 of 4lnmA
4rjyA Crystal structure of e. Coli l-threonine aldolase in complex with a non-covalently uncleaved bound l-serine substrate (see paper)
39% identity, 91% coverage: 8:334/360 of query aligns to 1:322/332 of 4rjyA
4lnlA Structure of escherichia coli threonine aldolase in complex with allo- thr (see paper)
39% identity, 91% coverage: 8:334/360 of query aligns to 1:322/332 of 4lnlA
4lnjA Structure of escherichia coli threonine aldolase in unliganded form (see paper)
39% identity, 91% coverage: 8:334/360 of query aligns to 1:322/332 of 4lnjA
O07051 L-allo-threonine aldolase; L-allo-TA; L-allo-threonine acetaldehyde-lyase; EC 4.1.2.49 from Aeromonas jandaei (see paper)
41% identity, 93% coverage: 9:343/360 of query aligns to 4:336/338 of O07051
3wgbD Crystal structure of aeromonas jandaei l-allo-threonine aldolase (see paper)
45% identity, 79% coverage: 9:292/360 of query aligns to 2:279/324 of 3wgbD
Sites not aligning to the query:
5vyeB Crystal structure of l-threonine aldolase from pseudomonas putida
27% identity, 63% coverage: 25:251/360 of query aligns to 20:238/344 of 5vyeB
O50584 Low specificity L-threonine aldolase; Low specificity L-TA; EC 4.1.2.48 from Pseudomonas sp. (strain NCIMB 10558) (see paper)
27% identity, 63% coverage: 25:251/360 of query aligns to 22:240/346 of O50584
>WP_089302170.1 NCBI__GCF_900188115.1:WP_089302170.1
MTSVRRALIDLRSDTLTVPDEPMRAAMAGAEVGDNVLDGDPTVRALEQRTAQLLGKPAAL
WTPSGTMANVIALCLHLQRGDRFLAPRDAHVLLNELGSAAWLAGGMPEAIGTDLGPGRPS
PHTLERIISAGRNAPYYALRTSLLCLENTHNAAGGAVIPADEHAQLVATARDGGLSVHLD
GARLWNAAVALNVPPAALTVGADSVSVCFSKGLGAPVGSALAGSAEFIEHARRTRQMLGG
GVRQGGVLAASCLKALDRMDELATDHANAARLASGLSDLGWDVPTPQTNIVLGAVADVER
TLHSLRELDILAMPMAGRVRFVVHRAITSAVIEEALERISTELPSSAVHSTSQAGMRLHL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory