SitesBLAST
Comparing WP_089302444.1 NCBI__GCF_900188115.1:WP_089302444.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8i01A Crystal structure of escherichia coli glyoxylate carboligase (see paper)
72% identity, 96% coverage: 1:585/608 of query aligns to 2:586/594 of 8i01A
- binding flavin-adenine dinucleotide: R155 (= R154), G212 (= G211), G213 (= G212), G214 (= G213), N217 (= N216), T238 (= T237), L239 (= L238), M240 (= M239), V256 (≠ A255), G257 (= G256), Q259 (= Q258), T260 (= T259), G279 (= G278), N280 (= N279), R281 (= R280), A283 (= A282), R285 (= R284), H286 (= H285), D303 (= D302), I304 (= I303), Q308 (= Q307), D322 (= D321), A323 (= A322), G417 (= G416)
- binding magnesium ion: D447 (= D446), F452 (= F451), E455 (= E454), N474 (= N473), Y476 (= Y475)
- binding thiamine diphosphate: G395 (= G394), L396 (= L395), S397 (= S396), L422 (= L421), G446 (= G445), D447 (= D446), F448 (≠ Y447), D449 (= D448), N474 (= N473), Y476 (= Y475), L477 (= L476), G478 (= G477), L479 (= L478), I480 (= I479)
- binding 2,3-dimethoxy-5-methyl-1,4-benzoquinone: Q354 (≠ A353), C492 (= C491), Q494 (= Q493)
Sites not aligning to the query:
8beoB Crystal structure of e. Coli glyoxylate carboligase mutant i393a with map
72% identity, 96% coverage: 3:585/608 of query aligns to 2:584/592 of 8beoB
- binding methyl hydrogen (s)-acetylphosphonate: C490 (= C491), Q492 (= Q493)
- binding flavin-adenine dinucleotide: R153 (= R154), P154 (= P155), G210 (= G211), G211 (= G212), G212 (= G213), N215 (= N216), T236 (= T237), L237 (= L238), M238 (= M239), V254 (≠ A255), G255 (= G256), Q257 (= Q258), T258 (= T259), G277 (= G278), N278 (= N279), R279 (= R280), A281 (= A282), R283 (= R284), H284 (= H285), D301 (= D302), I302 (= I303), Q306 (= Q307), D320 (= D321), A321 (= A322), G415 (= G416)
- binding magnesium ion: D445 (= D446), F450 (= F451), L451 (= L452), E453 (= E454), N472 (= N473), Y474 (= Y475)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(1s)-1-hydroxy-1-[(r)-hydroxy(methoxy)phosphoryl]ethyl}-5-(2-{[(s)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: R283 (= R284), G393 (= G394), L394 (= L395), S395 (= S396), L420 (= L421), G444 (= G445), D445 (= D446), F446 (≠ Y447), D447 (= D448), N472 (= N473), Y474 (= Y475), L475 (= L476), G476 (= G477), L477 (= L478), I478 (= I479)
- binding 2,3-dimethoxy-5-methyl-1,4-benzoquinone: Q352 (≠ A353), R356 (≠ E357)
Sites not aligning to the query:
8beoA Crystal structure of e. Coli glyoxylate carboligase mutant i393a with map
72% identity, 96% coverage: 3:585/608 of query aligns to 2:584/592 of 8beoA
- binding flavin-adenine dinucleotide: R153 (= R154), P154 (= P155), G210 (= G211), G211 (= G212), G212 (= G213), N215 (= N216), T236 (= T237), L237 (= L238), M238 (= M239), V254 (≠ A255), G255 (= G256), Q257 (= Q258), T258 (= T259), G277 (= G278), N278 (= N279), R279 (= R280), A281 (= A282), R283 (= R284), H284 (= H285), D301 (= D302), I302 (= I303), Q306 (= Q307), D320 (= D321), A321 (= A322), I397 (= I398), G415 (= G416)
- binding magnesium ion: R384 (≠ P385), V405 (= V406), F406 (≠ Y407), H410 (= H411), D445 (= D446), F450 (= F451), L451 (= L452), E453 (= E454), N472 (= N473), Y474 (= Y475)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(1s)-1-hydroxy-1-[(r)-hydroxy(methoxy)phosphoryl]ethyl}-5-(2-{[(s)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: R283 (= R284), G393 (= G394), L394 (= L395), S395 (= S396), L420 (= L421), G444 (= G445), D445 (= D446), F446 (≠ Y447), D447 (= D448), N472 (= N473), Y474 (= Y475), L475 (= L476), G476 (= G477), L477 (= L478), I478 (= I479)
- binding 2,3-dimethoxy-5-methyl-1,4-benzoquinone: E248 (= E249), Q352 (≠ A353)
Sites not aligning to the query:
8i07D Crystal structure of escherichia coli glyoxylate carboligase double mutant in complex with glycolaldehyde (see paper)
72% identity, 96% coverage: 1:585/608 of query aligns to 2:586/594 of 8i07D
- binding 2-oxidanylethanal: R285 (= R284), I480 (= I479)
- binding flavin-adenine dinucleotide: R155 (= R154), P156 (= P155), G212 (= G211), G213 (= G212), G214 (= G213), N217 (= N216), T238 (= T237), L239 (= L238), M240 (= M239), V256 (≠ A255), G257 (= G256), Q259 (= Q258), T260 (= T259), G279 (= G278), N280 (= N279), R281 (= R280), R285 (= R284), H286 (= H285), D303 (= D302), I304 (= I303), Q308 (= Q307), D322 (= D321), A323 (= A322), I399 (= I398), G417 (= G416)
- binding magnesium ion: D447 (= D446), F452 (= F451), L453 (= L452), E455 (= E454), N474 (= N473), Y476 (= Y475)
- binding thiamine diphosphate: V52 (= V51), T76 (= T75), G395 (= G394), L396 (= L395), S397 (= S396), L422 (= L421), G446 (= G445), D447 (= D446), F448 (≠ Y447), D449 (= D448), N474 (= N473), Y476 (= Y475), L477 (= L476), G478 (= G477), L479 (= L478), I480 (= I479)
- binding ubiquinone-1: Q354 (≠ A353), R358 (≠ E357), C492 (= C491), Q494 (= Q493)
Sites not aligning to the query:
8i07A Crystal structure of escherichia coli glyoxylate carboligase double mutant in complex with glycolaldehyde (see paper)
72% identity, 96% coverage: 1:585/608 of query aligns to 2:586/594 of 8i07A
- binding flavin-adenine dinucleotide: R155 (= R154), P156 (= P155), G212 (= G211), G213 (= G212), G214 (= G213), N217 (= N216), T238 (= T237), L239 (= L238), M240 (= M239), V256 (≠ A255), G257 (= G256), Q259 (= Q258), T260 (= T259), G279 (= G278), N280 (= N279), R281 (= R280), R285 (= R284), H286 (= H285), D303 (= D302), I304 (= I303), Q308 (= Q307), D322 (= D321), A323 (= A322), I394 (= I393), I399 (= I398), G417 (= G416)
- binding magnesium ion: D447 (= D446), F452 (= F451), L453 (= L452), E455 (= E454), N474 (= N473), Y476 (= Y475)
- binding thiamine diphosphate: I394 (= I393), G395 (= G394), L396 (= L395), S397 (= S396), L422 (= L421), G446 (= G445), D447 (= D446), F448 (≠ Y447), D449 (= D448), N474 (= N473), Y476 (= Y475), L477 (= L476), G478 (= G477), L479 (= L478), I480 (= I479)
- binding ubiquinone-1: Q354 (≠ A353), C492 (= C491), Q494 (= Q493)
Sites not aligning to the query:
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
34% identity, 90% coverage: 11:555/608 of query aligns to 101:638/667 of P09342
- C161 (= C72) modified: Disulfide link with 307
- P194 (= P105) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ I214) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
34% identity, 90% coverage: 11:555/608 of query aligns to 98:635/664 of P09114
- P191 (= P105) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (≠ A482) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
32% identity, 89% coverage: 11:554/608 of query aligns to 18:554/582 of 3ea4A
- active site: Y32 (≠ I25), G34 (= G27), G35 (≠ A28), A36 (= A29), S37 (≠ I30), E58 (≠ V51), T81 (= T75), F120 (= F114), Q121 (= Q115), E122 (≠ A116), K170 (≠ L164), M265 (≠ L257), V292 (≠ H285), V399 (≠ I393), G425 (= G419), M427 (≠ L421), D452 (= D446), N479 (= N473), H481 (≠ Y475), L482 (= L476), M484 (≠ L478), V485 (≠ I479), W488 (≠ A482)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (≠ N283), R291 (= R284), W488 (≠ A482)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R154), G221 (= G211), G222 (= G212), G223 (= G213), T245 (= T237), L246 (= L238), M247 (= M239), L263 (≠ A255), G264 (= G256), M265 (≠ L257), H266 (≠ Q258), G285 (= G278), R287 (= R280), D289 (≠ A282), R291 (= R284), D309 (= D302), I310 (= I303), G327 (≠ S320), D328 (= D321), V329 (≠ A322), M404 (≠ I398), G422 (= G416)
- binding magnesium ion: D452 (= D446), N479 (= N473), H481 (≠ Y475)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (≠ I393), G400 (= G394), Q401 (≠ L395), H402 (≠ S396), M427 (≠ L421), G451 (= G445), D452 (= D446), G453 (≠ Y447), S454 (≠ D448), N479 (= N473), H481 (≠ Y475), L482 (= L476), G483 (= G477), M484 (≠ L478), V485 (≠ I479)
Sites not aligning to the query:
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
32% identity, 89% coverage: 11:554/608 of query aligns to 18:554/582 of 3e9yA
- active site: Y32 (≠ I25), G34 (= G27), G35 (≠ A28), A36 (= A29), S37 (≠ I30), E58 (≠ V51), T81 (= T75), F120 (= F114), Q121 (= Q115), E122 (≠ A116), K170 (≠ L164), M265 (≠ L257), V292 (≠ H285), V399 (≠ I393), G425 (= G419), M427 (≠ L421), D452 (= D446), N479 (= N473), H481 (≠ Y475), L482 (= L476), M484 (≠ L478), V485 (≠ I479), W488 (≠ A482)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (≠ N283), R291 (= R284), W488 (≠ A482)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R154), G221 (= G211), G222 (= G212), G223 (= G213), T245 (= T237), L246 (= L238), M247 (= M239), L263 (≠ A255), G285 (= G278), R287 (= R280), D289 (≠ A282), R291 (= R284), D309 (= D302), I310 (= I303), G327 (≠ S320), D328 (= D321), V329 (≠ A322), M404 (≠ I398), G422 (= G416)
- binding magnesium ion: D452 (= D446), N479 (= N473), H481 (≠ Y475)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (≠ I393), G400 (= G394), Q401 (≠ L395), H402 (≠ S396), M427 (≠ L421), G451 (= G445), G453 (≠ Y447), S454 (≠ D448), N479 (= N473), H481 (≠ Y475), L482 (= L476), G483 (= G477), M484 (≠ L478), V485 (≠ I479)
Sites not aligning to the query:
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
32% identity, 89% coverage: 11:554/608 of query aligns to 19:555/585 of 5k2oA
- active site: Y33 (≠ I25), G35 (= G27), G36 (≠ A28), A37 (= A29), S38 (≠ I30), E59 (≠ V51), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (≠ A116), K171 (≠ L164), M266 (≠ L257), V293 (≠ H285), V400 (≠ I393), G426 (= G419), M428 (≠ L421), D453 (= D446), N480 (= N473), H482 (≠ Y475), L483 (= L476), M485 (≠ L478), V486 (≠ I479), W489 (≠ A482)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (≠ L257), R292 (= R284), W489 (≠ A482)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (≠ A255), G286 (= G278), R288 (= R280), D290 (≠ A282), V293 (≠ H285), D310 (= D302), I311 (= I303), D329 (= D321), V330 (≠ A322), Q404 (= Q397), M405 (≠ I398), G423 (= G416)
- binding magnesium ion: D453 (= D446), N480 (= N473), H482 (≠ Y475)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ I393), G401 (= G394), Q402 (≠ L395), H403 (≠ S396), M428 (≠ L421), D453 (= D446), G454 (≠ Y447), S455 (≠ D448), N480 (= N473), H482 (≠ Y475), L483 (= L476), G484 (= G477), M485 (≠ L478), V486 (≠ I479)
Sites not aligning to the query:
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
32% identity, 89% coverage: 11:554/608 of query aligns to 19:555/583 of 5k3sA
- active site: Y33 (≠ I25), G35 (= G27), G36 (≠ A28), A37 (= A29), S38 (≠ I30), E59 (≠ V51), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (≠ A116), K171 (≠ L164), M266 (≠ L257), V293 (≠ H285), V400 (≠ I393), G426 (= G419), M428 (≠ L421), D453 (= D446), N480 (= N473), H482 (≠ Y475), L483 (= L476), M485 (≠ L478), V486 (≠ I479), W489 (≠ A482)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R284), M485 (≠ L478), W489 (≠ A482)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (≠ A255), M266 (≠ L257), G286 (= G278), R288 (= R280), D290 (≠ A282), V293 (≠ H285), D310 (= D302), I311 (= I303), D329 (= D321), V330 (≠ A322), M405 (≠ I398), G423 (= G416)
- binding magnesium ion: D453 (= D446), N480 (= N473), H482 (≠ Y475)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ I393), G401 (= G394), Q402 (≠ L395), H403 (≠ S396), G426 (= G419), M428 (≠ L421), D453 (= D446), G454 (≠ Y447), S455 (≠ D448), N480 (= N473), H482 (≠ Y475), L483 (= L476), G484 (= G477), M485 (≠ L478), V486 (≠ I479)
Sites not aligning to the query:
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
32% identity, 89% coverage: 11:554/608 of query aligns to 104:640/670 of P17597
- A122 (= A29) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ N31) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (≠ V51) binding thiamine diphosphate
- S186 (= S94) binding FAD
- P197 (= P105) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ S107) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q115) binding thiamine diphosphate
- K220 (= K128) binding (R)-imazaquin
- R246 (= R154) binding (R)-imazaquin; binding FAD
- K256 (≠ L164) binding chlorimuron-ethyl
- G308 (= G212) binding FAD
- TL 331:332 (= TL 237:238) binding FAD
- C340 (≠ D246) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (≠ AGLQ 255:258) binding FAD
- GVRFD 371:375 (≠ GNRWA 278:282) binding FAD
- DR 376:377 (≠ NR 283:284) binding chlorimuron-ethyl
- DI 395:396 (= DI 302:303) binding FAD
- DV 414:415 (≠ DA 321:322) binding FAD
- QH 487:488 (≠ LS 395:396) binding thiamine diphosphate
- GG 508:509 (≠ GQ 416:417) binding FAD
- GAM 511:513 (≠ GPL 419:421) binding thiamine diphosphate
- D538 (= D446) binding Mg(2+)
- DGS 538:540 (≠ DYD 446:448) binding thiamine diphosphate
- N565 (= N473) binding Mg(2+)
- NQHLGM 565:570 (≠ NSYLGL 473:478) binding thiamine diphosphate
- H567 (≠ Y475) binding Mg(2+)
- W574 (≠ A482) binding chlorimuron-ethyl; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
Sites not aligning to the query:
- 653 binding chlorimuron-ethyl; S→A: No effect on catalytic activity or sensitivity to herbicides.; S→F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; S→N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; S→T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
9c4rA Acetolactate synthase, chloroplastic (see paper)
32% identity, 89% coverage: 11:554/608 of query aligns to 19:555/582 of 9c4rA
- binding 2-(2-chloroethoxy)-N-[(4-methoxy-6-methylpyrimidin-2-yl)carbamoyl]benzene-1-sulfonamide: M266 (≠ L257), R292 (= R284), W489 (≠ A482)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ I393), G401 (= G394), Q402 (≠ L395), H403 (≠ S396), G426 (= G419), M428 (≠ L421), G452 (= G445), G454 (≠ Y447), S455 (≠ D448), M458 (≠ F451), N480 (= N473), H482 (≠ Y475), L483 (= L476), G484 (= G477), M485 (≠ L478), V486 (≠ I479)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (≠ A255), M266 (≠ L257), H267 (≠ Q258), G286 (= G278), V287 (≠ N279), R288 (= R280), D290 (≠ A282), V293 (≠ H285), D310 (= D302), I311 (= I303), D329 (= D321), V330 (≠ A322), M405 (≠ I398), G423 (= G416)
- binding magnesium ion: D453 (= D446), N480 (= N473), H482 (≠ Y475)
Sites not aligning to the query:
9c4qA Acetolactate synthase, chloroplastic (see paper)
32% identity, 89% coverage: 11:554/608 of query aligns to 19:555/582 of 9c4qA
- binding 2-(2-fluoroethoxy)-N-[(4-methoxy-6-methylpyrimidin-2-yl)carbamoyl]benzene-1-sulfonamide: M266 (≠ L257), D291 (≠ N283), R292 (= R284), W489 (≠ A482)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ I393), G401 (= G394), Q402 (≠ L395), H403 (≠ S396), G426 (= G419), M428 (≠ L421), G452 (= G445), D453 (= D446), G454 (≠ Y447), S455 (≠ D448), N480 (= N473), H482 (≠ Y475), L483 (= L476), G484 (= G477), M485 (≠ L478), V486 (≠ I479)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), M263 (= M254), L264 (≠ A255), M266 (≠ L257), H267 (≠ Q258), G286 (= G278), V287 (≠ N279), R288 (= R280), D290 (≠ A282), R292 (= R284), V293 (≠ H285), D310 (= D302), I311 (= I303), D329 (= D321), V330 (≠ A322), M405 (≠ I398), G423 (= G416)
- binding magnesium ion: Y381 (≠ R374), D453 (= D446), N480 (= N473), H482 (≠ Y475), K533 (≠ P528)
- binding oxygen molecule: M458 (≠ F451), Q461 (≠ E454)
Sites not aligning to the query:
9c4pA Acetolactate synthase, chloroplastic (see paper)
32% identity, 89% coverage: 11:554/608 of query aligns to 19:555/582 of 9c4pA
- binding 2-(2-chloroethoxy)-N-[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)carbamoyl]benzene-1-sulfonamide: M266 (≠ L257), D291 (≠ N283), R292 (= R284), M485 (≠ L478), W489 (≠ A482)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ I393), G401 (= G394), Q402 (≠ L395), H403 (≠ S396), G426 (= G419), M428 (≠ L421), G452 (= G445), D453 (= D446), G454 (≠ Y447), S455 (≠ D448), M458 (≠ F451), N480 (= N473), H482 (≠ Y475), L483 (= L476), G484 (= G477), M485 (≠ L478), V486 (≠ I479)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), M263 (= M254), L264 (≠ A255), M266 (≠ L257), H267 (≠ Q258), G286 (= G278), V287 (≠ N279), R288 (= R280), D290 (≠ A282), R292 (= R284), V293 (≠ H285), D310 (= D302), I311 (= I303), D329 (= D321), V330 (≠ A322), M405 (≠ I398), G423 (= G416), G424 (≠ Q417)
- binding magnesium ion: D453 (= D446), N480 (= N473), H482 (≠ Y475)
Sites not aligning to the query:
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
32% identity, 89% coverage: 11:554/608 of query aligns to 19:555/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ I393), G401 (= G394), Q402 (≠ L395), H403 (≠ S396), G426 (= G419), M428 (≠ L421), G452 (= G445), D453 (= D446), G454 (≠ Y447), S455 (≠ D448), M458 (≠ F451), N480 (= N473), H482 (≠ Y475), L483 (= L476), G484 (= G477), M485 (≠ L478), V486 (≠ I479)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (≠ A255), M266 (≠ L257), H267 (≠ Q258), G286 (= G278), V287 (≠ N279), R288 (= R280), D290 (≠ A282), R292 (= R284), V293 (≠ H285), D310 (= D302), I311 (= I303), D329 (= D321), V330 (≠ A322), M405 (≠ I398), G423 (= G416)
- binding magnesium ion: F370 (≠ R361), D453 (= D446), M458 (≠ F451), Q461 (≠ E454), N480 (= N473), H482 (≠ Y475), K533 (≠ P528)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ L257), R292 (= R284), M485 (≠ L478), W489 (≠ A482)
Sites not aligning to the query:
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
32% identity, 89% coverage: 11:554/608 of query aligns to 19:555/582 of 5wj1A
- active site: Y33 (≠ I25), G35 (= G27), G36 (≠ A28), A37 (= A29), S38 (≠ I30), E59 (≠ V51), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (≠ A116), K171 (≠ L164), M266 (≠ L257), V293 (≠ H285), V400 (≠ I393), G426 (= G419), M428 (≠ L421), D453 (= D446), N480 (= N473), H482 (≠ Y475), L483 (= L476), M485 (≠ L478), V486 (≠ I479), W489 (≠ A482)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), M263 (= M254), L264 (≠ A255), G286 (= G278), R288 (= R280), V293 (≠ H285), D310 (= D302), I311 (= I303), D329 (= D321), V330 (≠ A322), M405 (≠ I398), G423 (= G416), G424 (≠ Q417)
- binding magnesium ion: D453 (= D446), N480 (= N473), H482 (≠ Y475)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (≠ L257), D291 (≠ N283), R292 (= R284), M485 (≠ L478), W489 (≠ A482)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ I393), G401 (= G394), Q402 (≠ L395), H403 (≠ S396), M428 (≠ L421), D453 (= D446), G454 (≠ Y447), S455 (≠ D448), M458 (≠ F451), N480 (= N473), H482 (≠ Y475), L483 (= L476), G484 (= G477), M485 (≠ L478), V486 (≠ I479)
Sites not aligning to the query:
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
32% identity, 89% coverage: 11:554/608 of query aligns to 19:555/582 of 5k6tA
- active site: Y33 (≠ I25), G35 (= G27), G36 (≠ A28), A37 (= A29), S38 (≠ I30), E59 (≠ V51), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (≠ A116), K171 (≠ L164), M266 (≠ L257), V293 (≠ H285), V400 (≠ I393), G426 (= G419), M428 (≠ L421), D453 (= D446), N480 (= N473), H482 (≠ Y475), L483 (= L476), M485 (≠ L478), V486 (≠ I479), W489 (≠ A482)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (≠ Q258), R292 (= R284), M485 (≠ L478), W489 (≠ A482)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (≠ A255), G286 (= G278), R288 (= R280), D290 (≠ A282), R292 (= R284), V293 (≠ H285), D310 (= D302), I311 (= I303), D329 (= D321), V330 (≠ A322), Q404 (= Q397), M405 (≠ I398), G423 (= G416)
- binding magnesium ion: D453 (= D446), N480 (= N473), H482 (≠ Y475)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ I393), G401 (= G394), Q402 (≠ L395), H403 (≠ S396), G426 (= G419), M428 (≠ L421), G452 (= G445), G454 (≠ Y447), S455 (≠ D448), N480 (= N473), H482 (≠ Y475), L483 (= L476), G484 (= G477)
Sites not aligning to the query:
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
32% identity, 89% coverage: 11:554/608 of query aligns to 19:555/582 of 5k6rA
- active site: Y33 (≠ I25), G35 (= G27), G36 (≠ A28), A37 (= A29), S38 (≠ I30), E59 (≠ V51), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (≠ A116), K171 (≠ L164), M266 (≠ L257), V293 (≠ H285), V400 (≠ I393), G426 (= G419), M428 (≠ L421), D453 (= D446), N480 (= N473), H482 (≠ Y475), L483 (= L476), M485 (≠ L478), V486 (≠ I479), W489 (≠ A482)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R284), W489 (≠ A482)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (≠ A255), M266 (≠ L257), G286 (= G278), R288 (= R280), R292 (= R284), V293 (≠ H285), D310 (= D302), I311 (= I303), G328 (≠ S320), D329 (= D321), V330 (≠ A322), M405 (≠ I398), G423 (= G416)
- binding magnesium ion: D453 (= D446), N480 (= N473), H482 (≠ Y475)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ I393), G401 (= G394), Q402 (≠ L395), H403 (≠ S396), G426 (= G419), M428 (≠ L421), D453 (= D446), G454 (≠ Y447), S455 (≠ D448), M458 (≠ F451), N480 (= N473), H482 (≠ Y475), L483 (= L476), G484 (= G477), M485 (≠ L478), V486 (≠ I479)
Sites not aligning to the query:
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
32% identity, 89% coverage: 11:554/608 of query aligns to 19:555/582 of 1z8nA
- active site: Y33 (≠ I25), G35 (= G27), G36 (≠ A28), A37 (= A29), S38 (≠ I30), E59 (≠ V51), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (≠ A116), K171 (≠ L164), M266 (≠ L257), V293 (≠ H285), V400 (≠ I393), G426 (= G419), M428 (≠ L421), D453 (= D446), N480 (= N473), H482 (≠ Y475), L483 (= L476), M485 (≠ L478), V486 (≠ I479), W489 (≠ A482)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K128), R161 (= R154), Y191 (≠ H184), R194 (≠ S187), D291 (≠ N283), R292 (= R284), D312 (≠ E304), W489 (≠ A482)
- binding flavin-adenine dinucleotide: R161 (= R154), G222 (= G211), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (≠ A255), G265 (= G256), M266 (≠ L257), H267 (≠ Q258), G286 (= G278), V287 (≠ N279), R288 (= R280), D290 (≠ A282), R292 (= R284), V293 (≠ H285), D310 (= D302), I311 (= I303), D329 (= D321), V330 (≠ A322), M405 (≠ I398), G423 (= G416), G424 (≠ Q417)
- binding magnesium ion: D453 (= D446), N480 (= N473)
- binding thiamine diphosphate: V400 (≠ I393), G401 (= G394), Q402 (≠ L395), H403 (≠ S396), G426 (= G419), M428 (≠ L421), G452 (= G445), G454 (≠ Y447), S455 (≠ D448), N480 (= N473), H482 (≠ Y475), L483 (= L476), G484 (= G477), M485 (≠ L478), V486 (≠ I479)
Sites not aligning to the query:
Query Sequence
>WP_089302444.1 NCBI__GCF_900188115.1:WP_089302444.1
MPRMTAARAAVEVLKREGVSDAFGIPGAAINPLYAAMRDSGGIDHVLARHVEGASHMAEG
YTRTAAGNIGVCIGTSGPAGTDMITGLYSASADSIPILCITGQAPRSRLHKEDFQAVDIP
SIAKPLTKMALTVLEPSQVPGAFQRAFHEMRSGRPGPVLIDLPLDVQQSEIEFDPDTYEP
MPVHRPSATRAQIEKALGMLCRAERPLIVAGGGIINADSSDLLVSFAETVGVPVVPTLMG
WGSIPDDHELMAGMAGLQTAHRYGNATLLESDFVLGIGNRWANRHTGGLETYTRGRTFVH
VDIEPTQIGRVFAPDYGITSDAGAALELFADIAHEWAEQGQLPDRRAWVRDCAERKEALH
RRTHFDNVPIKPQRVYEEMNRAFGPETRYVSSIGLSQIAAAQFLHVYRPRHWINCGQAGP
LGWTVPAALGVCKADPEATVVALSGDYDLQFLLEELAVGAQFNLPYVHVVVNNSYLGLIR
QAQRQFDMDYCVQLSFDNINTPELGAYGVDHLKVAEGLGCKALRVTEPDQLLPAFDEARK
LMLEYRVPVLVEAILERVTNISMGTEIDGINEFEDLATTLEDAPTSVVPQARQDGATGPE
HARPALTD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory