Comparing WP_089322378.1 NCBI__GCF_900188395.1:WP_089322378.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
28% identity, 99% coverage: 2:352/356 of query aligns to 8:379/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
28% identity, 99% coverage: 2:352/356 of query aligns to 4:375/377 of P44514
7uoiA Crystallographic structure of dape from enterococcus faecium
28% identity, 95% coverage: 2:338/356 of query aligns to 9:364/383 of 7uoiA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
23% identity, 69% coverage: 23:268/356 of query aligns to 21:282/377 of 7t1qA
Sites not aligning to the query:
7rsfA Acetylornithine deacetylase from escherichia coli
26% identity, 98% coverage: 4:352/356 of query aligns to 6:374/380 of 7rsfA
7lgpB Dape enzyme from shigella flexneri
26% identity, 70% coverage: 3:252/356 of query aligns to 7:267/377 of 7lgpB
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
24% identity, 99% coverage: 2:352/356 of query aligns to 4:375/375 of 4pqaA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
24% identity, 99% coverage: 2:352/356 of query aligns to 4:375/376 of 4o23A
1cg2A Carboxypeptidase g2 (see paper)
29% identity, 72% coverage: 3:259/356 of query aligns to 18:278/389 of 1cg2A
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
29% identity, 74% coverage: 3:264/356 of query aligns to 43:308/415 of P06621
Sites not aligning to the query:
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
24% identity, 99% coverage: 1:352/356 of query aligns to 1:334/341 of 5xoyA
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
30% identity, 43% coverage: 3:155/356 of query aligns to 7:167/258 of 4h2kA
Sites not aligning to the query:
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
29% identity, 57% coverage: 56:259/356 of query aligns to 13:213/392 of 7m6uB
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
28% identity, 45% coverage: 3:162/356 of query aligns to 5:171/265 of 4op4B
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
22% identity, 56% coverage: 4:202/356 of query aligns to 22:244/426 of 3pfoA
Sites not aligning to the query:
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
22% identity, 81% coverage: 55:343/356 of query aligns to 62:353/366 of Q8P8J5
>WP_089322378.1 NCBI__GCF_900188395.1:WP_089322378.1
MEVVEILKKLIEIPSVYGNEKEIADFCEEFMKDKNPSLTVNRTGNTLLAYKKLNEGKPTI
ALVGHLDTVPGINEFTNKIIDGKLHGLGASDMKGGDAVILKIAGDYALKESPYNLIFLLY
EKEEGPYLESGLIPLFEKFKDILKKINLAIILEPTDNTVQVGCLGVIHCGMVFKGKRAHS
ARPWQGENAIHKGWKLLKLLSEKKPKKYTFFGLDYYEVINATMVEFTGGRNIIPDSFTIN
INYRFAPSKTVEEAQRELENLGKEVGVEKFEWRDLSPSGKVCLDNPILSRFIEKYNLKVE
PKQAWTDVARFSQWNIDAVNFGPGQPSQAHQKNEYIELKKLKENYKILSNFLFPTK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory