Comparing WP_089322549.1 NCBI__GCF_900188395.1:WP_089322549.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
41% identity, 94% coverage: 2:237/251 of query aligns to 4:254/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
41% identity, 94% coverage: 2:236/251 of query aligns to 4:253/253 of 1g9xB
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
31% identity, 94% coverage: 2:237/251 of query aligns to 2:236/240 of 6mjpA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
36% identity, 88% coverage: 5:224/251 of query aligns to 4:223/240 of 4ymuJ
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 91% coverage: 2:230/251 of query aligns to 1:234/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
36% identity, 91% coverage: 2:230/251 of query aligns to 2:235/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
36% identity, 91% coverage: 2:230/251 of query aligns to 2:235/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
36% identity, 91% coverage: 2:230/251 of query aligns to 2:235/344 of 6cvlD
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
32% identity, 94% coverage: 3:237/251 of query aligns to 3:236/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
32% identity, 94% coverage: 3:237/251 of query aligns to 3:236/238 of 6s8gA
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
36% identity, 89% coverage: 2:224/251 of query aligns to 4:223/285 of 4yerA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
32% identity, 93% coverage: 3:236/251 of query aligns to 3:235/235 of 6mhzA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
32% identity, 94% coverage: 1:236/251 of query aligns to 5:238/240 of 1ji0A
6mbnA Lptb e163q in complex with atp (see paper)
31% identity, 94% coverage: 3:237/251 of query aligns to 4:237/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 93% coverage: 3:235/251 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 93% coverage: 3:235/251 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
31% identity, 92% coverage: 3:234/251 of query aligns to 3:233/233 of 6b8bA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 91% coverage: 2:229/251 of query aligns to 2:228/241 of 4u00A
5x40A Structure of a cbio dimer bound with amppcp (see paper)
33% identity, 90% coverage: 2:227/251 of query aligns to 4:230/280 of 5x40A
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 91% coverage: 2:229/251 of query aligns to 3:230/242 of 3c4jA
>WP_089322549.1 NCBI__GCF_900188395.1:WP_089322549.1
MILKVENLTKRFKGLVALDHVSFSVERGMILGIIGPNGAGKTTLFKCITSVYKPTEGKVY
FKGEDVTDLPTYKKARLGIARTHQIVRPLKDLTVLKNVMVGACFGKKSASLKESEQIAEE
ILKFVKLYDKKDVEAGKLNVPQKKRLELARALAGEPELLLLDEVLAGLTPGEVKEMLEII
KEIRRQGITILMIEHLMHAIMNISDRIVVLDYGKKIAEGSPEEVANDPKVIEAYLGDPEA
ALKLLKEKRDV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory