Comparing WP_089323706.1 NCBI__GCF_900188395.1:WP_089323706.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2p3nA Thermotoga maritima impase tm1415 (see paper)
31% identity, 88% coverage: 8:247/274 of query aligns to 7:219/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
31% identity, 88% coverage: 8:247/274 of query aligns to 7:219/256 of O33832
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
29% identity, 92% coverage: 1:251/274 of query aligns to 1:234/267 of P0ADG4
Sites not aligning to the query:
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
29% identity, 92% coverage: 1:251/274 of query aligns to 5:238/270 of 6ib8B
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
27% identity, 92% coverage: 1:251/274 of query aligns to 1:234/262 of 2qflA
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 84% coverage: 16:246/274 of query aligns to 22:238/271 of Q9M8S8
O14732 Inositol monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol monophosphatase A2; EC 3.1.3.25 from Homo sapiens (Human) (see 2 papers)
28% identity, 91% coverage: 3:252/274 of query aligns to 18:254/288 of O14732
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
29% identity, 94% coverage: 4:261/274 of query aligns to 3:240/258 of 3lv0A
2cziA Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions (see paper)
29% identity, 91% coverage: 3:252/274 of query aligns to 4:231/259 of 2cziA
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
29% identity, 81% coverage: 26:248/274 of query aligns to 25:229/255 of 5yhtA
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 81% coverage: 26:248/274 of query aligns to 28:232/260 of P95189
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
29% identity, 81% coverage: 26:248/274 of query aligns to 26:230/256 of 5zonA
6tqoT Rrn anti-termination complex (see paper)
28% identity, 92% coverage: 1:251/274 of query aligns to 1:226/255 of 6tqoT
3luzA Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
28% identity, 94% coverage: 4:261/274 of query aligns to 3:222/238 of 3luzA
P32179 3'(2'),5'-bisphosphate nucleotidase; 3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase; 3'-phosphoadenosine-5'-phosphate phosphatase; 3'-phosphoadenosine-5'-phosphatase; PAP phosphatase; PAPase; DPNPase; Halotolerance protein HAL2; Methionine-requiring protein 22; EC 3.1.3.7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
25% identity, 88% coverage: 2:242/274 of query aligns to 5:307/357 of P32179
1qgxA X-ray structure of yeast hal2p (see paper)
25% identity, 88% coverage: 2:242/274 of query aligns to 4:306/354 of 1qgxA
1ka1A The papase hal2p complexed with calcium and magnesium ions and reaction substrate: pap (see paper)
25% identity, 88% coverage: 2:242/274 of query aligns to 4:306/354 of 1ka1A
1k9zA The papase hal2p complexed with zinc ions
25% identity, 88% coverage: 2:242/274 of query aligns to 4:306/354 of 1k9zA
Sites not aligning to the query:
1k9yA The papase hal2p complexed with magnesium ions and reaction products: amp and inorganic phosphate (see paper)
25% identity, 88% coverage: 2:242/274 of query aligns to 4:306/354 of 1k9yA
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 45% coverage: 6:127/274 of query aligns to 86:211/346 of Q6NPM8
>WP_089323706.1 NCBI__GCF_900188395.1:WP_089323706.1
MRELLFVAITTALKAGDAIMKIYERDFTVEEKADNSPLTEADRVSHKIIVTHLHDFPVLS
EEGKEIPYEERKNWEKLWIVDPLDGTKEFIKRNGEFTVNIAFVEKGVPVLGVVYAPAIGV
LYYGGQGFGAFKVENGDFSFLEDITSSEVFWRELSKVAVSLPVIDDRKEIVVVASRSHRN
PETEEFIRQIEKKYGKVKTISQGSSLKLTAVAEGKADVYPRIAPTMEWDTAAGQAVVEAA
GGKVVEYETGNLLRYNKENLLNPYFVAFRKGFFV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory