Comparing WP_089323728.1 NCBI__GCF_900188395.1:WP_089323728.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3jtxB Crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution
35% identity, 97% coverage: 1:376/387 of query aligns to 1:393/393 of 3jtxB
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
31% identity, 91% coverage: 20:372/387 of query aligns to 9:368/380 of 2x5dD
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
30% identity, 94% coverage: 18:379/387 of query aligns to 23:388/392 of 6l1oB
Sites not aligning to the query:
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
30% identity, 94% coverage: 18:379/387 of query aligns to 23:388/393 of 6l1lB
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
30% identity, 94% coverage: 18:379/387 of query aligns to 23:387/393 of 6l1nA
Sites not aligning to the query:
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
30% identity, 93% coverage: 15:372/387 of query aligns to 7:375/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
30% identity, 93% coverage: 15:372/387 of query aligns to 7:375/388 of 1gd9A
2o1bA Structure of aminotransferase from staphylococcus aureus
28% identity, 89% coverage: 30:372/387 of query aligns to 21:365/376 of 2o1bA
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
29% identity, 95% coverage: 19:386/387 of query aligns to 26:402/402 of P14909
Sites not aligning to the query:
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
26% identity, 96% coverage: 5:377/387 of query aligns to 6:366/370 of Q58097
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
27% identity, 90% coverage: 5:353/387 of query aligns to 8:358/385 of Q56232
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
27% identity, 90% coverage: 5:353/387 of query aligns to 8:358/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
27% identity, 90% coverage: 5:353/387 of query aligns to 8:358/382 of 1bjwA
Sites not aligning to the query:
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
27% identity, 90% coverage: 5:353/387 of query aligns to 8:358/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
27% identity, 87% coverage: 17:353/387 of query aligns to 19:358/382 of 1gc4A
Sites not aligning to the query:
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
27% identity, 87% coverage: 17:353/387 of query aligns to 19:358/382 of 1gc3A
Sites not aligning to the query:
8wkjA The crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila (see paper)
24% identity, 90% coverage: 27:373/387 of query aligns to 30:384/391 of 8wkjA
1v2fA Crystal structure of t.Th hb8 glutamine aminotransferase complex with 3-phenylpropionate (see paper)
26% identity, 76% coverage: 32:324/387 of query aligns to 29:315/368 of 1v2fA
Sites not aligning to the query:
1v2eA Crystal structure of t.Th hb8 glutamine aminotransferase complex with a-keto-g-methylthiobutyrate (see paper)
26% identity, 76% coverage: 32:324/387 of query aligns to 29:315/368 of 1v2eA
Sites not aligning to the query:
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
25% identity, 93% coverage: 13:372/387 of query aligns to 23:375/384 of 1o4sB
>WP_089323728.1 NCBI__GCF_900188395.1:WP_089323728.1
MNSVLRNMKPYPMDELVKAKELLKKDGKKIYDFGTGDPKEPTAPFIREAVKTAIPEVSQY
PTVKGRKDLREAISSWFKRRFDVELDSEKEIIPSAGSKEAIFHFPLVFIDADSDKKRVIF
GTPAYPVYERGTLFAQGIPTSYTLKYEEGFLLRLDKMPEEILKETKIVWLNYPHNPTGAT
APLSYFEDMYQICREYDIIMCSDECYTEIYFEEKPPSALQVGKENVVVFHSLSKRSGMTG
YRSGFVAGDSRIIQEYLRFRSSFGVGSPDFIQVGAREAWKDESHVEERRLIFRKKKEIFE
KFFKEEGFEFLDVKASFYFWVKVPFGLTSKDYAFHLLKYGIVVSPGEFFGSGGEGFFRIA
LVPSVDECEEAVSVWREANREIARRRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory