Comparing WP_090216766.1 NCBI__GCF_002796795.1:WP_090216766.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59954 Adenylyltransferase and sulfurtransferase uba4; Common component for nitrate reductase and xanthine dehydrogenase protein F; Ubiquitin-like protein activator 4; EC 2.7.7.80; EC 2.8.1.11 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see paper)
44% identity, 61% coverage: 3:203/330 of query aligns to 68:279/482 of O59954
Q9VLJ8 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Ubiquitin activating enzyme 4; EC 2.7.7.80; EC 2.8.1.11 from Drosophila melanogaster (Fruit fly) (see paper)
39% identity, 69% coverage: 1:228/330 of query aligns to 69:299/453 of Q9VLJ8
Sites not aligning to the query:
P38820 Adenylyltransferase and sulfurtransferase UBA4; Needs CLA4 to survive protein 3; Ubiquitin-like protein activator 4; EC 2.7.7.-; EC 2.8.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 4 papers)
29% identity, 93% coverage: 3:309/330 of query aligns to 46:413/440 of P38820
P12282 Molybdopterin-synthase adenylyltransferase; MoaD protein adenylase; Molybdopterin-converting factor subunit 1 adenylase; Sulfur carrier protein MoaD adenylyltransferase; EC 2.7.7.80 from Escherichia coli (strain K12) (see 2 papers)
35% identity, 71% coverage: 1:235/330 of query aligns to 9:245/249 of P12282
Sites not aligning to the query:
6yubB Crystal structure of uba4 from chaetomium thermophilum (see paper)
37% identity, 62% coverage: 1:205/330 of query aligns to 12:215/289 of 6yubB
Sites not aligning to the query:
1jwbB Structure of the covalent acyl-adenylate form of the moeb-moad protein complex (see paper)
36% identity, 71% coverage: 1:235/330 of query aligns to 8:237/240 of 1jwbB
Sites not aligning to the query:
1jw9B Structure of the native moeb-moad protein complex (see paper)
36% identity, 71% coverage: 1:235/330 of query aligns to 8:237/240 of 1jw9B
Sites not aligning to the query:
D4GSF3 SAMP-activating enzyme E1; Ubiquitin-like activating enzyme of archaea; Ubl-activating enzyme; EC 2.7.7.- from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii) (see paper)
35% identity, 71% coverage: 1:233/330 of query aligns to 10:244/270 of D4GSF3
6yubA Crystal structure of uba4 from chaetomium thermophilum (see paper)
36% identity, 62% coverage: 1:205/330 of query aligns to 11:216/423 of 6yubA
Sites not aligning to the query:
O95396 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Molybdopterin synthase sulfurylase; MPT synthase sulfurylase; EC 2.7.7.80; EC 2.8.1.11 from Homo sapiens (Human) (see 5 papers)
38% identity, 67% coverage: 3:223/330 of query aligns to 62:285/460 of O95396
Sites not aligning to the query:
1zfnA Structural analysis of escherichia coli thif (see paper)
38% identity, 67% coverage: 3:223/330 of query aligns to 8:229/244 of 1zfnA
Sites not aligning to the query:
P30138 Sulfur carrier protein ThiS adenylyltransferase; EC 2.7.7.73 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 67% coverage: 3:223/330 of query aligns to 8:229/251 of P30138
Sites not aligning to the query:
1jwaB Structure of the atp-bound moeb-moad protein complex (see paper)
35% identity, 68% coverage: 1:223/330 of query aligns to 8:210/217 of 1jwaB
Q72J02 Sulfur carrier protein adenylyltransferase; E1-like protein TtuC; Sulfur carrier protein MoaD adenylyltransferase; Sulfur carrier protein ThiS adenylyltransferase; Sulfur carrier protein TtuB adenylyltransferase; tRNA two-thiouridine-synthesizing protein C; EC 2.7.7.80; EC 2.7.7.73; EC 2.7.7.- from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
36% identity, 66% coverage: 1:217/330 of query aligns to 8:232/271 of Q72J02
Sites not aligning to the query:
1zud3 Structure of this-thif protein complex (see paper)
36% identity, 67% coverage: 3:223/330 of query aligns to 8:224/240 of 1zud3
Sites not aligning to the query:
Q19360 NEDD8-activating enzyme E1 catalytic subunit; Ectopic membrane ruffles in embryo protein 1; Ubiquitin-activating enzyme 3 homolog; EC 6.2.1.64 from Caenorhabditis elegans (see paper)
37% identity, 37% coverage: 14:134/330 of query aligns to 33:153/430 of Q19360
Sites not aligning to the query:
1y8qB Sumo e1 activating enzyme sae1-sae2-mg-atp complex (see paper)
33% identity, 41% coverage: 19:154/330 of query aligns to 8:141/510 of 1y8qB
Sites not aligning to the query:
3kycB Human sumo e1 complex with a sumo1-amp mimic (see paper)
33% identity, 41% coverage: 19:154/330 of query aligns to 9:142/548 of 3kycB
Sites not aligning to the query:
Q7SXG4 SUMO-activating enzyme subunit 2; Ubiquitin-like 1-activating enzyme E1B; Ubiquitin-like modifier-activating enzyme 2; EC 2.3.2.- from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
33% identity, 41% coverage: 19:154/330 of query aligns to 14:147/650 of Q7SXG4
Sites not aligning to the query:
3kydB Human sumo e1~sumo1-amp tetrahedral intermediate mimic (see paper)
33% identity, 41% coverage: 19:154/330 of query aligns to 10:143/477 of 3kydB
Sites not aligning to the query:
>WP_090216766.1 NCBI__GCF_002796795.1:WP_090216766.1
MSRYARQIAVSEFGPHGQEALRHARLLVIGAGGLAAPVLPYLAAAGVGTIKLADPDIVDL
SNLHRQTLFTMDDIGLSKATSAAKHLSARNPECLIETHVAPFDPDTAHDLCNDIDLVLDC
ADSFAASYIASDICGKRNIPLISASVVEMGGYVGGFCAGAPSLRAVFPDLPRASGTCATL
GVLGPIVGIIATLQAQMAISVLTGQSPSPLGQLITFEGTGFRFGGFRFDTAPEPEYRPSF
ISAQTIDDTDLIIDLRRPEEGPLAHVTAQRRTVEDIAENPPKADAKTRIVLCCRSGLRAW
AAAEHLSQQHAGPVALVALGDQSDQHGEHS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory