Comparing WP_090272147.1 NCBI__GCF_900105005.1:WP_090272147.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
45% identity, 100% coverage: 4:649/649 of query aligns to 3:648/648 of P75831
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
43% identity, 100% coverage: 2:649/649 of query aligns to 1:650/650 of 5ws4A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
41% identity, 99% coverage: 5:647/649 of query aligns to 3:615/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
40% identity, 99% coverage: 5:647/649 of query aligns to 3:591/592 of 5lj7A
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
53% identity, 35% coverage: 5:228/649 of query aligns to 3:226/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
48% identity, 34% coverage: 5:226/649 of query aligns to 1:227/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
48% identity, 34% coverage: 5:226/649 of query aligns to 1:227/230 of 1l2tA
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
44% identity, 34% coverage: 1:223/649 of query aligns to 1:224/233 of P75957
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
43% identity, 34% coverage: 2:223/649 of query aligns to 1:223/229 of 7v8iD
7mdyC Lolcde nucleotide-bound
44% identity, 34% coverage: 5:223/649 of query aligns to 2:221/226 of 7mdyC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
44% identity, 34% coverage: 5:223/649 of query aligns to 2:221/222 of 7arlD
9gvkD Cryo-em structure of endogenous atp-bound lolcde with lold-e171q mutations in nanodiscs (see paper)
43% identity, 34% coverage: 5:223/649 of query aligns to 3:222/226 of 9gvkD
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
43% identity, 34% coverage: 9:228/649 of query aligns to 7:222/223 of 2pclA
8g4cB Bceabs atpgs high res tm (see paper)
41% identity, 33% coverage: 11:222/649 of query aligns to 9:221/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
40% identity, 33% coverage: 11:222/649 of query aligns to 8:220/245 of 7tchB
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 34% coverage: 5:222/649 of query aligns to 1:219/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 34% coverage: 5:222/649 of query aligns to 2:220/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
39% identity, 32% coverage: 5:209/649 of query aligns to 2:206/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
39% identity, 32% coverage: 5:209/649 of query aligns to 2:206/344 of 3tuiC
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
40% identity, 33% coverage: 6:217/649 of query aligns to 4:215/330 of P9WQK5
>WP_090272147.1 NCBI__GCF_900105005.1:WP_090272147.1
MNEPLISLEGISRTYRNGELSTTVLHDVALDIHAGEFVAIMGASGSGKSTLMHLLGCLDK
PTTGRYLFEGEDIARLDSDQLAGLRSRTFGFIFQSYHLISSANATENVEVPAIYAGLPRD
VRHARAEELLTGLGLGERLQNRPNQLSGGQQQRVSIARALMNDARILLADEPTGALDSKS
GHDVLELLKDLHARGKTVIVITHDREVANHADRLIEIRDGRITHDSGRKPSPAQQLATPP
PRPAPKQGLAAFGDINEAVRMALRALQANLFRTVLTLLGIVIGVASVVVMLAVGNGARQD
VVERISDMGTNLLLVRPGAPNTRRSADGTTNTLTPEDAVVASRVDNVVAAVPEVDTRATV
RAGNTDAQTQVTGTTADYPLAKSWPLASGVFINDEDNRRYAAVAVIGRTVATNLYGDADP
LGQYMLIRNVPFLIIGVMQEKGATPWGQDQDDAVFVPLNTASNRLIGSRHLGSISVLIDD
LSLSDATQEAVRQAIMANHSGIEDFQIRNMASLLENIASTQDTFTVLLGSIAAISLLVGG
IGVMNIMLVNVSERTREIGIRMATGARTRNILQQFIIEAMVVSAIGGAIGVAVGLGFAAM
LQSFGTSIQFTAGPVLLAFGCAFATGLIFGFMPAHKAAHLDPVVALSAD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory