Comparing WP_090276042.1 NCBI__GCF_900105005.1:WP_090276042.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
7cdyA Crystal structure of glucose dehydrogenase
43% identity, 79% coverage: 89:424/425 of query aligns to 10:346/346 of 7cdyA
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
41% identity, 79% coverage: 88:423/425 of query aligns to 11:347/348 of 2g8sA
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
41% identity, 81% coverage: 78:423/425 of query aligns to 20:369/371 of P75804
7cgzA Glucose dehydrogenase
42% identity, 79% coverage: 89:424/425 of query aligns to 10:321/321 of 7cgzA
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
32% identity, 80% coverage: 81:421/425 of query aligns to 2:332/333 of 2ismB
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
32% identity, 81% coverage: 81:425/425 of query aligns to 4:337/338 of 3a9hA
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
32% identity, 81% coverage: 81:425/425 of query aligns to 4:337/338 of 3a9gA
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
30% identity, 82% coverage: 72:421/425 of query aligns to 1:331/334 of 3dasA
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
31% identity, 53% coverage: 86:311/425 of query aligns to 23:269/453 of 5minB
Sites not aligning to the query:
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
31% identity, 53% coverage: 86:311/425 of query aligns to 23:263/444 of 1cq1A
Sites not aligning to the query:
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
31% identity, 53% coverage: 86:311/425 of query aligns to 23:263/444 of 1c9uA
Sites not aligning to the query:
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
31% identity, 53% coverage: 86:311/425 of query aligns to 47:293/478 of P13650
Sites not aligning to the query:
8re0A Quinoprotein glucose dehydrogenase B (see paper)
31% identity, 53% coverage: 86:311/425 of query aligns to 23:269/452 of 8re0A
Sites not aligning to the query:
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
31% identity, 53% coverage: 86:311/425 of query aligns to 23:267/448 of 1cruA
Sites not aligning to the query:
>WP_090276042.1 NCBI__GCF_900105005.1:WP_090276042.1
MVPYRHSLIFLATLGLLAGCDNSATPDKQTDAPTPTVTESESNTRAHDQSSAEASSAEKE
SAEQAAAGQPTADPGTDALPFSVSEVTQFDSPWAMTFLPDGRLLVTEMAGTLRLHDLAGE
RSGTIGGVPEVVHAGQGGLGDVLLHPQFETNQHIYLSYAEAGDGGAGAAVARARLVLDDE
GSGKLEDLDVIWRQTPKLSGNGHFGHRLAFDSDGMLWISSSERQAFDPSQDMNSNLGKVV
RLNDDGSVPEDNPFTDQGEIAAQVWSLGHRNILGMAFDSSGKLWAHEMGPEGGDELNLIE
KGANYGYPLVSNGNHYDGTSIPDHDTRPEFKTPAITWTPVISPAGFIIYDGELFADWQGS
GFIGGMSSLSLVRVEFDGEKAHEAERFDMQKRIREVEQGPDGAIWLLEDGMRGGDGQLLK
LTPSE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory