Comparing WP_090276478.1 NCBI__GCF_900105005.1:WP_090276478.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hwgA Structure of phosphorylated enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system (see paper)
39% identity, 72% coverage: 183:728/755 of query aligns to 6:554/572 of 2hwgA
P08839 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 72% coverage: 183:728/755 of query aligns to 7:555/575 of P08839
P23533 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Staphylococcus carnosus (strain TM300) (see paper)
37% identity, 73% coverage: 177:726/755 of query aligns to 4:554/573 of P23533
2wqdA Crystal structure of enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system in the dephosphorylated state (see paper)
35% identity, 72% coverage: 180:726/755 of query aligns to 6:554/570 of 2wqdA
2xz7A Crystal structure of the phosphoenolpyruvate-binding domain of enzyme i in complex with phosphoenolpyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
45% identity, 42% coverage: 425:743/755 of query aligns to 3:322/324 of 2xz7A
2xz9A Crystal structure from the phosphoenolpyruvate-binding domain of enzyme i in complex with pyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
45% identity, 42% coverage: 430:743/755 of query aligns to 1:315/317 of 2xz9A
5lu4A C4-type pyruvate phosphate dikinase: conformational intermediate of central domain in the swiveling mechanism (see paper)
26% identity, 51% coverage: 328:713/755 of query aligns to 423:850/850 of 5lu4A
Sites not aligning to the query:
5jvjB C4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer (see paper)
24% identity, 51% coverage: 328:713/755 of query aligns to 350:795/797 of 5jvjB
Sites not aligning to the query:
O23404 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 51% coverage: 328:713/755 of query aligns to 512:960/963 of O23404
5jvlA C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
25% identity, 51% coverage: 328:713/755 of query aligns to 423:872/874 of 5jvlA
Sites not aligning to the query:
Q39735 Pyruvate, phosphate dikinase, chloroplastic; Cold-sensitive pyruvate, orthophosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Flaveria bidentis (Coastal plain yellowtops) (Ethulia bidentis) (see 2 papers)
25% identity, 51% coverage: 328:713/755 of query aligns to 502:951/953 of Q39735
Sites not aligning to the query:
1kc7A Pyruvate phosphate dikinase with bound mg-phosphonopyruvate (see paper)
24% identity, 47% coverage: 352:704/755 of query aligns to 443:859/872 of 1kc7A
Sites not aligning to the query:
P22983 Pyruvate, phosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Clostridium symbiosum (Bacteroides symbiosus) (see 4 papers)
24% identity, 47% coverage: 352:704/755 of query aligns to 444:860/874 of P22983
Sites not aligning to the query:
Q02KR1 Phosphoenolpyruvate synthase; PEP synthase; Pyruvate, water dikinase; EC 2.7.9.2 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
27% identity, 46% coverage: 349:699/755 of query aligns to 404:773/791 of Q02KR1
5jvlB C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
26% identity, 36% coverage: 442:713/755 of query aligns to 180:518/520 of 5jvlB
Sites not aligning to the query:
1vbgA Pyruvate phosphate dikinase from maize (see paper)
24% identity, 52% coverage: 328:722/755 of query aligns to 423:874/874 of 1vbgA
Sites not aligning to the query:
P11155 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Zea mays (Maize) (see 7 papers)
26% identity, 52% coverage: 328:722/755 of query aligns to 496:947/947 of P11155
Sites not aligning to the query:
1vbhA Pyruvate phosphate dikinase with bound mg-pep from maize (see paper)
24% identity, 52% coverage: 328:722/755 of query aligns to 414:862/862 of 1vbhA
Sites not aligning to the query:
P37349 PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 from Escherichia coli (strain K12) (see paper)
28% identity, 23% coverage: 201:373/755 of query aligns to 267:440/472 of P37349
Sites not aligning to the query:
P14099 cGMP-dependent 3',5'-cyclic phosphodiesterase; Cyclic GMP-stimulated phosphodiesterase; CGS-PDE; cGSPDE; EC 3.1.4.17 from Bos taurus (Bovine) (see paper)
27% identity, 19% coverage: 17:157/755 of query aligns to 389:531/921 of P14099
Sites not aligning to the query:
>WP_090276478.1 NCBI__GCF_900105005.1:WP_090276478.1
MLNTLRRIVQEVNAAKDLASALNIIVYRVREAMETHVCSVYLLNPDTDRYELMATEGLNK
DAVGVVSLGSNEGLVGYVGIREEPVNLEDAAAHPRFRYFVETGEERYASFLGVPIIHHRQ
VMGVLVIQQKDRRQFDEVEESFLVTMSAQLAGVIAHAEATGAMRGLGWAGEVIQDTRFDA
VPGAPGVAIGRAVVMLPPADLKAVPDKEVKDIDAEIALYRKAVEAVHADIKRLSAKLAAQ
LRPEELALFDVYLMMLDDSSLGNEIIAGIRQGQWAQGALRDVINAHVARFELMDDPYLQE
RAADIKDLGRRLLACLQEAGRQRLTFPRKTILVAEELTPAMLGEVPKDRLVGLVSVLGSG
SSHVAILARAMGIPTVMGAVDLPYLRMDKLELIVDGNAGEVYSNPSQELRRHYRELIREE
MELSHGLEKLRAEPCVTLDGHRVPLWVNTGLFADIARSLDRGAEGVGLYRTEVPFMILDR
FPSEKEQQATYRAQLEAFHPLPVTMRTLDVGGDKALSYFPIKEDNPFLGWRGIRVTLDHP
EIFLVQIRAMLKASEGLENLRIMLPMISSVNEVEEALHLIHRAHGEVLDEGISVPMPPVG
VMIEVPAAVYQARELAQRVDFLSVGTNDLTQYLLAVDRNNPRVADLYHSLHPAVLQALML
VARACREAGKPMSVCGEMAGDPAAAVLLLAMGCDVLSMNATNLPRVKWLLRQIRLSDAQA
LLNEALSQDNAYLVQSILHLALRKMGLGKVLMLVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory