Comparing WP_090447976.1 NCBI__GCF_900100495.1:WP_090447976.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1q0zA Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin a (dcma) (see paper)
31% identity, 85% coverage: 31:319/339 of query aligns to 5:295/297 of 1q0zA
1q0rA Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin t (dcmat) (see paper)
31% identity, 85% coverage: 31:319/339 of query aligns to 5:295/297 of 1q0rA
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 86% coverage: 32:321/339 of query aligns to 5:260/262 of 6eb3C
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 86% coverage: 32:321/339 of query aligns to 5:263/265 of 6eb3A
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 86% coverage: 32:321/339 of query aligns to 5:266/268 of 6eb3B
O07732 Bifunctional lipase/adenylate cyclase LipJ; EC 3.1.1.-; EC 4.6.1.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
30% identity, 69% coverage: 78:310/339 of query aligns to 63:275/462 of O07732
Sites not aligning to the query:
Q86WA6 Valacyclovir hydrolase; VACVase; Valacyclovirase; Biphenyl hydrolase-like protein; Biphenyl hydrolase-related protein; Bph-rp; Breast epithelial mucin-associated antigen; MCNAA; EC 3.1.-.- from Homo sapiens (Human) (see 2 papers)
26% identity, 84% coverage: 24:307/339 of query aligns to 37:284/291 of Q86WA6
Sites not aligning to the query:
2ociA Crystal structure of valacyclovir hydrolase complexed with a product analogue (see paper)
28% identity, 83% coverage: 26:307/339 of query aligns to 2:247/254 of 2ociA
2ocgA Crystal structure of human valacyclovir hydrolase (see paper)
28% identity, 83% coverage: 26:307/339 of query aligns to 2:247/254 of 2ocgA
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
27% identity, 71% coverage: 49:289/339 of query aligns to 24:232/261 of 2xuaH
Sites not aligning to the query:
6i8wB Crystal structure of a membrane phospholipase a, a novel bacterial virulence factor (see paper)
28% identity, 52% coverage: 20:194/339 of query aligns to 34:183/310 of 6i8wB
Sites not aligning to the query:
2zjfA Crystal structure of mycobacterium tuberculosis epoxide hydrolase b complexed with an inhibitor (see paper)
28% identity, 41% coverage: 49:187/339 of query aligns to 25:153/346 of 2zjfA
Sites not aligning to the query:
3heaA The l29p/l124i mutation of pseudomonas fluorescens esterase (see paper)
24% identity, 68% coverage: 72:301/339 of query aligns to 42:253/271 of 3heaA
Sites not aligning to the query:
3ia2A Pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog (see paper)
24% identity, 68% coverage: 72:301/339 of query aligns to 42:253/271 of 3ia2A
Sites not aligning to the query:
3hi4A Switching catalysis from hydrolysis to perhydrolysis in p. Fluorescens esterase (see paper)
24% identity, 68% coverage: 72:301/339 of query aligns to 42:253/271 of 3hi4A
Sites not aligning to the query:
P22862 Arylesterase; Aryl-ester hydrolase; Carboxylic acid perhydrolase; PFE; Putative bromoperoxidase; EC 3.1.1.2; EC 1.-.-.- from Pseudomonas fluorescens (see 5 papers)
24% identity, 68% coverage: 72:301/339 of query aligns to 43:254/272 of P22862
Sites not aligning to the query:
P47229 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; 2,6-dioxo-6-phenylhexa-3-enoate hydrolase; EC 3.7.1.8 from Paraburkholderia xenovorans (strain LB400) (see paper)
28% identity, 50% coverage: 129:299/339 of query aligns to 96:265/286 of P47229
2og1A Crystal structure of bphd, a c-c hydrolase from burkholderia xenovorans lb400 (see paper)
28% identity, 50% coverage: 129:299/339 of query aligns to 95:264/285 of 2og1A
Sites not aligning to the query:
2rhwA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3,10-di-fluoro hopda (see paper)
27% identity, 50% coverage: 129:299/339 of query aligns to 93:262/283 of 2rhwA
Sites not aligning to the query:
2rhtA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3-cl hopda (see paper)
27% identity, 50% coverage: 129:299/339 of query aligns to 93:262/283 of 2rhtA
Sites not aligning to the query:
>WP_090447976.1 NCBI__GCF_900100495.1:WP_090447976.1
MRALIFLAVLLCGWPVLARERCDVQVATAKVELGEVQLAYQSIGRTSDPVLLMVMGLGGQ
LIHWPDEVVARLCDQGFRVIRFDNRDVGLSRWTHAAPPANLGYEALRYRLGLSVSAPYRL
RDMAGDALGLMDALGVRQFHVLGASMGGMIAQHLADLAPQRVQSLTLIMTSSGAAGLPAP
SPALLELLAKREAPSREVALEQQADLLAALGSPAVSDDRQALLQQAETAYDRAFNPEGVQ
RQLLAILAEPSRVELLNRLRLPTLVVHGTADPLLPAMHGVHVAAHIRGSALKLIPGLAHR
FQEAFKEPLLAAVLPHLQANQLAGSRIARLPASEWSYIQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory