SitesBLAST
Comparing WP_090659870.1 NCBI__GCF_900101615.1:WP_090659870.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 99% coverage: 5:349/350 of query aligns to 17:373/378 of P69874
- C26 (≠ R14) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F15) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F33) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ S42) mutation to T: Loss of ATPase activity and transport.
- L60 (= L48) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (= L64) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V123) mutation to M: Loss of ATPase activity and transport.
- D172 (= D160) mutation to N: Loss of ATPase activity and transport.
- C276 (= C257) mutation to A: Lower ATPase activity and transport efficiency.
- E297 (= E278) mutation E->K,D: Lower ATPase activity and transport efficiency.; mutation to Q: Loss of ATPase activity and transport.
8y5iA Cryo-em structure of e.Coli spermidine transporter potd-potabc in translocation intermidiate state (see paper)
43% identity, 99% coverage: 5:349/350 of query aligns to 2:358/358 of 8y5iA
2d62A Crystal structure of multiple sugar binding transport atp-binding protein
43% identity, 78% coverage: 10:281/350 of query aligns to 11:298/375 of 2d62A
1g291 Malk (see paper)
44% identity, 78% coverage: 6:278/350 of query aligns to 4:292/372 of 1g291
- binding magnesium ion: D69 (≠ G71), E71 (vs. gap), K72 (vs. gap), K79 (≠ H75), D80 (≠ A76), E292 (= E278)
- binding pyrophosphate 2-: S38 (= S40), G39 (= G41), C40 (≠ S42), G41 (= G43), K42 (= K44), T43 (≠ S45), T44 (= T46)
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
44% identity, 79% coverage: 6:280/350 of query aligns to 7:278/353 of 1vciA
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
38% identity, 97% coverage: 3:343/350 of query aligns to 1:350/371 of P68187
- A85 (= A87) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ A108) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V116) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ G119) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ A121) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ E126) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G139) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D160) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (= R230) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- F241 (≠ I241) mutation to I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- W267 (vs. gap) mutation to G: Normal maltose transport but constitutive mal gene expression.
- G278 (= G268) mutation to P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- S282 (≠ A272) mutation to L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G284 (≠ A274) mutation to S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G302 (= G295) mutation to D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- E308 (≠ A301) mutation to Q: Maltose transport is affected but retains ability to interact with MalT.
- S322 (≠ G315) mutation to F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G340 (= G333) mutation to A: Maltose transport is affected but retains ability to interact with MalT.
- G346 (= G339) mutation to S: Normal maltose transport but constitutive mal gene expression.
Sites not aligning to the query:
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
38% identity, 97% coverage: 4:343/350 of query aligns to 1:349/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
38% identity, 97% coverage: 4:343/350 of query aligns to 1:349/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F15), S37 (= S40), G38 (= G41), C39 (≠ S42), G40 (= G43), K41 (= K44), S42 (= S45), T43 (= T46), Q81 (= Q84), R128 (= R131), A132 (≠ Q135), S134 (= S137), G136 (= G139), Q137 (= Q140), E158 (= E161), H191 (= H194)
- binding magnesium ion: S42 (= S45), Q81 (= Q84)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
38% identity, 97% coverage: 4:343/350 of query aligns to 1:349/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F15), G38 (= G41), C39 (≠ S42), G40 (= G43), K41 (= K44), S42 (= S45), T43 (= T46), R128 (= R131), S134 (= S137), Q137 (= Q140)
- binding beryllium trifluoride ion: S37 (= S40), G38 (= G41), K41 (= K44), Q81 (= Q84), S134 (= S137), G136 (= G139), H191 (= H194)
- binding magnesium ion: S42 (= S45), Q81 (= Q84)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
38% identity, 97% coverage: 4:343/350 of query aligns to 1:349/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F15), V17 (≠ A20), G38 (= G41), C39 (≠ S42), G40 (= G43), K41 (= K44), S42 (= S45), T43 (= T46), R128 (= R131), A132 (≠ Q135), S134 (= S137), Q137 (= Q140)
- binding tetrafluoroaluminate ion: S37 (= S40), G38 (= G41), K41 (= K44), Q81 (= Q84), S134 (= S137), G135 (= G138), G136 (= G139), E158 (= E161), H191 (= H194)
- binding magnesium ion: S42 (= S45), Q81 (= Q84)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
38% identity, 97% coverage: 4:343/350 of query aligns to 1:349/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F15), V17 (≠ A20), G38 (= G41), C39 (≠ S42), G40 (= G43), K41 (= K44), S42 (= S45), T43 (= T46), R128 (= R131), A132 (≠ Q135), S134 (= S137), Q137 (= Q140)
- binding magnesium ion: S42 (= S45), Q81 (= Q84)
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
38% identity, 97% coverage: 6:343/350 of query aligns to 1:347/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F15), S35 (= S40), G36 (= G41), C37 (≠ S42), G38 (= G43), K39 (= K44), S40 (= S45), T41 (= T46), R126 (= R131), A130 (≠ Q135), S132 (= S137), G134 (= G139), Q135 (= Q140)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 97% coverage: 3:343/350 of query aligns to 1:348/369 of P19566
- L86 (= L88) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P162) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D167) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- E306 (≠ A301) mutation to K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
3d31A Modbc from methanosarcina acetivorans (see paper)
35% identity, 97% coverage: 5:345/350 of query aligns to 1:344/348 of 3d31A
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
43% identity, 75% coverage: 20:281/350 of query aligns to 19:288/393 of P9WQI3
- H193 (= H194) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 89% coverage: 8:318/350 of query aligns to 6:321/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 89% coverage: 8:318/350 of query aligns to 6:321/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 89% coverage: 8:318/350 of query aligns to 6:321/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
35% identity, 89% coverage: 8:318/350 of query aligns to 6:321/353 of Q97UY8
- S142 (= S137) mutation to A: Decrease in ATPase activity. Can form dimers.
- G144 (= G139) mutation to A: Loss of ATPase activity. Cannot form dimers. Forms an active heterodimer; when associated with A-166.
- E166 (= E161) mutation to A: Loss of ATPase activity. Can form dimers in the presence of ATP-Mg(2+). Forms an active heterodimer; when associated with A-144.; mutation to Q: Strong decrease in ATPase activity. Can form dimers in the presence of ATP alone, without Mg(2+).
2awnC Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
38% identity, 91% coverage: 24:343/350 of query aligns to 14:319/344 of 2awnC
Sites not aligning to the query:
Query Sequence
>WP_090659870.1 NCBI__GCF_900101615.1:WP_090659870.1
MSVALLRTEGLSKRFGQTLALDGLDLDVRPGEFLALLGGSGSGKSTLLRLVAGFEAPDAG
RILLEGRDLAGLPPHARPVSMMFQSYALFPHLSVFDNVAYGLRREGVARAEIARRVAEGL
ALVGLEGTAGRKPHQLSGGQRQRVALIRALVKRPRLLMLDEPLAALDAGLRERTGLELRA
LQRRTGAGFVMVTHDQGEALALADRIAVLEGGRLAQCGTPAELYERPASRFVARFLGAAN
ILEGRVATDGLVEAAGCRLALPHDRPAGADLAVALRPERIRLLPGTPPATNAATGRLRDL
AYRGDGWMALVALPGGTELRVALPVDAAPPAPGAQLVLGWPAEALVPLAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory