Comparing WP_092052720.1 NCBI__GCF_900111775.1:WP_092052720.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1vc4B Crystal structure of indole-3-glycerol phosphate synthase (trpc) from thermus thermophilus at 1.8 a resolution (see paper)
42% identity, 90% coverage: 13:225/236 of query aligns to 38:250/254 of 1vc4B
3t78A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate
37% identity, 90% coverage: 7:219/236 of query aligns to 38:244/257 of 3t78A
3t55A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba)
37% identity, 90% coverage: 7:219/236 of query aligns to 38:246/258 of 3t55A
3t44A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with indole glycerol phosphate (igp) amd anthranilate
37% identity, 90% coverage: 7:219/236 of query aligns to 38:246/259 of 3t44A
1lbfA Crystal structure of indole-3-glycerol phosphate syntase (igps)with reduced 1-(o-caboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) (see paper)
35% identity, 83% coverage: 20:216/236 of query aligns to 47:237/247 of 1lbfA
Sites not aligning to the query:
1jukA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus in a trigonal crystal form (see paper)
35% identity, 83% coverage: 20:216/236 of query aligns to 47:237/247 of 1jukA
1igsA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus at 2.0 a resolution (see paper)
35% identity, 83% coverage: 20:216/236 of query aligns to 47:237/247 of 1igsA
1a53A Complex of indole-3-glycerolphosphate synthase from sulfolobus solfataricus with indole-3-glycerolphosphate at 2.0 a resolution (see paper)
35% identity, 83% coverage: 20:216/236 of query aligns to 47:237/247 of 1a53A
3t40A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) complex with n-2-carboxyphenyl glycine (cpg)
36% identity, 77% coverage: 39:219/236 of query aligns to 60:232/251 of 3t40A
Sites not aligning to the query:
4iwwA Computational design of an unnatural amino acid metalloprotein with atomic level accuracy (see paper)
33% identity, 83% coverage: 20:216/236 of query aligns to 47:237/247 of 4iwwA
1jcmP Trpc stability mutant containing an engineered disulphide bridge and in complex with a cdrp-related substrate (see paper)
35% identity, 93% coverage: 4:223/236 of query aligns to 38:248/259 of 1jcmP
Sites not aligning to the query:
5k7jA Structure of designed zinc binding protein ze2 bound to zn2+ (see paper)
31% identity, 83% coverage: 20:216/236 of query aligns to 47:230/240 of 5k7jA
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
35% identity, 93% coverage: 4:223/236 of query aligns to 38:248/452 of 1piiA
Sites not aligning to the query:
4pa8A Crystal structure of a de novo retro-aldolase catalyzing asymmetric michael additions, with a covalently bound product analog (see paper)
31% identity, 77% coverage: 35:216/236 of query aligns to 52:227/236 of 4pa8A
4ou1A Crystal structure of a computationally designed retro-aldolase covalently bound to folding probe 1 [(6-methoxynaphthalen-2-yl) (oxiran-2-yl)methanol] (see paper)
32% identity, 76% coverage: 38:216/236 of query aligns to 63:237/247 of 4ou1A
Sites not aligning to the query:
6y88B Igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp (see paper)
32% identity, 91% coverage: 5:219/236 of query aligns to 42:254/265 of 6y88B
4a2rA Structure of the engineered retro-aldolase ra95.5-5 (see paper)
31% identity, 76% coverage: 38:216/236 of query aligns to 63:237/247 of 4a2rA
Sites not aligning to the query:
3uzjA Designed protein ke59 r13 3/11h with benzotriazole (see paper)
31% identity, 76% coverage: 38:216/236 of query aligns to 63:237/247 of 3uzjA
3uz5A Designed protein ke59 r13 3/11h (see paper)
31% identity, 76% coverage: 38:216/236 of query aligns to 63:237/247 of 3uz5A
3uxdA Designed protein ke59 r1 7/10h with dichlorobenzotriazole (dbt) (see paper)
32% identity, 76% coverage: 38:216/236 of query aligns to 63:237/247 of 3uxdA
>WP_092052720.1 NCBI__GCF_900111775.1:WP_092052720.1
MYTRFSDALIARKEAGFIPVIPDIKCISPKEGDLLRGRDPLAVAQLLARAGAPALSVVTE
TKDFGGSLELLRQLAKNTTLPILRKDFITSCEDMTLSRECGAQAILLICALHTLDSLTTL
YNEALKIGLEPLVEAHTEEELGWAGKIGAKLVGINNRDILKLEKDDGTVSATELLASHKP
KNAILISESSIRTPAEGQAAIRAGADVLLIGTALWQADDMAASYQAFSRSSEIPPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory