Comparing WP_092052742.1 NCBI__GCF_900111775.1:WP_092052742.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
2f06A Crystal structure of protein bt0572 from bacteroides thetaiotaomicron
43% identity, 100% coverage: 1:143/143 of query aligns to 4:144/144 of 2f06A
>WP_092052742.1 NCBI__GCF_900111775.1:WP_092052742.1
MKVEQISIFIENKSGRLAEVTRVLGEAGVNIRALSLADTSDFGILRLIVNKTDEAKAVLK
SKGFTVNKTDVVAVEVPDRPLGLNSILEILDQGKVNVEYMYAFVERCGENAVIIFRFDNT
DDAIQVLTQGGITILTGERIYNM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory